Budorcas taxicolor (takin): 128051558 Help Entry 128051558         CDS       T08909                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism btax  Budorcas taxicolor (takin) Pathway btax04060   Cytokine-cytokine receptor interaction btax04151   PI3K-Akt signaling pathway btax04630   JAK-STAT signaling pathway btax04640   Hematopoietic cell lineage btax04657   IL-17 signaling pathway btax04658   Th1 and Th2 cell differentiation btax04659   Th17 cell differentiation btax04660   T cell receptor signaling pathway btax04664   Fc epsilon RI signaling pathway btax04672   Intestinal immune network for IgA production btax05140   Leishmaniasis btax05200   Pathways in cancer btax05310   Asthma btax05320   Autoimmune thyroid disease btax05321   Inflammatory bowel disease btax05330   Allograft rejection Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     128051558 (IL4)    04151 PI3K-Akt signaling pathway     128051558 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128051558 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     128051558 (IL4)    04660 T cell receptor signaling pathway     128051558 (IL4)    04658 Th1 and Th2 cell differentiation     128051558 (IL4)    04659 Th17 cell differentiation     128051558 (IL4)    04657 IL-17 signaling pathway     128051558 (IL4)    04664 Fc epsilon RI signaling pathway     128051558 (IL4)    04672 Intestinal immune network for IgA production     128051558 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128051558 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     128051558 (IL4)   09163 Immune disease    05310 Asthma     128051558 (IL4)    05320 Autoimmune thyroid disease     128051558 (IL4)    05321 Inflammatory bowel disease     128051558 (IL4)    05330 Allograft rejection     128051558 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:btax04052]     128051558 (IL4)    00536 Glycosaminoglycan binding proteins [BR:btax00536]     128051558 (IL4) Cytokines and neuropeptides [BR:btax04052]  Cytokines   Interleukins    128051558 (IL4) Glycosaminoglycan binding proteins [BR:btax00536]  Heparan sulfate / Heparin   Cytokines    128051558 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  128051558 NCBI-ProteinID:  XP_052500145 LinkDB All DBs Position 7:complement(21740721..21748383) Genome browser AA seq 135 aa AA seqDB search MGLTSQLIPALVCLLVCTSHFVHGHKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAP KNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDL LERLKTIMKEKYSKC NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccagctgatcccagcgctggtctgcttactggtatgtaccagccac ttcgtccatggacacaagtgtgatattaccttagaagagatcatcaaaacgctgaacatc ctcacatcgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca aagaacgcaactgagaaggaaaccttctgcagggctggaattgagcttaggcgtatctac aggagccacatgtgcttgaacaaattcctgggcggacttgacaggaatctcagcagcctg gcaagcaagacctgttctgtgaatgaagccaagacgagtacaagtacgctgagagacctc ttggaaaggctaaagactattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system