Budorcas taxicolor (takin): 128052637 Help Entry 128052637         CDS       T08909                                  Name (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism btax  Budorcas taxicolor (takin) Pathway btax04060   Cytokine-cytokine receptor interaction btax04151   PI3K-Akt signaling pathway btax04217   Necroptosis btax04380   Osteoclast differentiation btax04620   Toll-like receptor signaling pathway btax04621   NOD-like receptor signaling pathway btax04622   RIG-I-like receptor signaling pathway btax04623   Cytosolic DNA-sensing pathway btax04630   JAK-STAT signaling pathway btax04650   Natural killer cell mediated cytotoxicity btax04668   TNF signaling pathway btax04936   Alcoholic liver disease btax05135   Yersinia infection btax05142   Chagas disease btax05152   Tuberculosis btax05160   Hepatitis C btax05161   Hepatitis B btax05162   Measles btax05163   Human cytomegalovirus infection btax05164   Influenza A btax05165   Human papillomavirus infection btax05167   Kaposi sarcoma-associated herpesvirus infection btax05168   Herpes simplex virus 1 infection btax05169   Epstein-Barr virus infection btax05170   Human immunodeficiency virus 1 infection btax05171   Coronavirus disease - COVID-19 btax05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     128052637    04668 TNF signaling pathway     128052637    04151 PI3K-Akt signaling pathway     128052637   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128052637  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     128052637  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128052637    04621 NOD-like receptor signaling pathway     128052637    04622 RIG-I-like receptor signaling pathway     128052637    04623 Cytosolic DNA-sensing pathway     128052637    04650 Natural killer cell mediated cytotoxicity     128052637   09158 Development and regeneration    04380 Osteoclast differentiation     128052637  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     128052637    05161 Hepatitis B     128052637    05160 Hepatitis C     128052637    05171 Coronavirus disease - COVID-19     128052637    05164 Influenza A     128052637    05162 Measles     128052637    05168 Herpes simplex virus 1 infection     128052637    05163 Human cytomegalovirus infection     128052637    05167 Kaposi sarcoma-associated herpesvirus infection     128052637    05169 Epstein-Barr virus infection     128052637    05165 Human papillomavirus infection     128052637   09171 Infectious disease: bacterial    05135 Yersinia infection     128052637    05152 Tuberculosis     128052637   09174 Infectious disease: parasitic    05142 Chagas disease     128052637   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128052637   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     128052637  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:btax04052]     128052637 Cytokines and neuropeptides [BR:btax04052]  Cytokines   Interferons    128052637 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Aip3p_Bud6_N PEX6_N Motif Other DBs NCBI-GeneID:  128052637 NCBI-ProteinID:  XP_052501179 LinkDB All DBs Position 8:complement(26149152..26149712) Genome browser AA seq 186 aa AA seqDB search MTYRCLLQMALLLCLSTTALCRSYSLLRFQQRRSTAVCEKLLQQLPATPQHCLEARMDFQ VPEEMKQAQQFRKEDAVLVMYEMLQQIFNILTRDFSSTGWSDAIIEHLLEELYGQMNYLE PIQKEIRQKQNSTTGDTTILRLKKYYFNLTQHLKSKEHNRCAWTVVPVQLLRNFSFLKSL TGSLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggctctcctgctgtgtctctccaccacagctctt tgcaggagctacagcttgcttcgattccaacaaaggcggagcactgcggtgtgcgagaaa cttctgcagcagttacctgcaactcctcaacattgcctggaggccaggatggacttccag gtccccgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg tatgagatgctccagcagatcttcaatattctcaccagagacttctccagcactggctgg tctgacgccatcatagagcacctccttgaggaactctatgggcagatgaattatctggag ccaatccagaaggaaataaggcagaagcaaaactccactacgggagacacgaccattctt cgcctgaagaaatattacttcaacctcacgcagcacctgaagtccaaggagcacaacagg tgtgcctggacagtcgtgccagtgcaattgctcaggaacttttctttcctgaagagccta acaggttccctccgggactga

DBGET integrated database retrieval system