Budorcas taxicolor (takin): 128064672 Help Entry 128064672         CDS       T08909                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism btax  Budorcas taxicolor (takin) Pathway btax01522   Endocrine resistance btax01524   Platinum drug resistance btax04010   MAPK signaling pathway btax04071   Sphingolipid signaling pathway btax04110   Cell cycle btax04115   p53 signaling pathway btax04137   Mitophagy - animal btax04151   PI3K-Akt signaling pathway btax04210   Apoptosis btax04211   Longevity regulating pathway btax04216   Ferroptosis btax04218   Cellular senescence btax04310   Wnt signaling pathway btax04722   Neurotrophin signaling pathway btax04919   Thyroid hormone signaling pathway btax05012   Parkinson disease btax05014   Amyotrophic lateral sclerosis btax05016   Huntington disease btax05160   Hepatitis C btax05161   Hepatitis B btax05162   Measles btax05163   Human cytomegalovirus infection btax05165   Human papillomavirus infection btax05166   Human T-cell leukemia virus 1 infection btax05167   Kaposi sarcoma-associated herpesvirus infection btax05168   Herpes simplex virus 1 infection btax05169   Epstein-Barr virus infection btax05200   Pathways in cancer btax05202   Transcriptional misregulation in cancer btax05203   Viral carcinogenesis btax05205   Proteoglycans in cancer btax05206   MicroRNAs in cancer btax05210   Colorectal cancer btax05212   Pancreatic cancer btax05213   Endometrial cancer btax05214   Glioma btax05215   Prostate cancer btax05216   Thyroid cancer btax05217   Basal cell carcinoma btax05218   Melanoma btax05219   Bladder cancer btax05220   Chronic myeloid leukemia btax05222   Small cell lung cancer btax05223   Non-small cell lung cancer btax05224   Breast cancer btax05225   Hepatocellular carcinoma btax05226   Gastric cancer btax05230   Central carbon metabolism in cancer btax05417   Lipid and atherosclerosis btax05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128064672 (TP53)    04310 Wnt signaling pathway     128064672 (TP53)    04071 Sphingolipid signaling pathway     128064672 (TP53)    04151 PI3K-Akt signaling pathway     128064672 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     128064672 (TP53)   09143 Cell growth and death    04110 Cell cycle     128064672 (TP53)    04210 Apoptosis     128064672 (TP53)    04216 Ferroptosis     128064672 (TP53)    04115 p53 signaling pathway     128064672 (TP53)    04218 Cellular senescence     128064672 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     128064672 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     128064672 (TP53)   09149 Aging    04211 Longevity regulating pathway     128064672 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128064672 (TP53)    05202 Transcriptional misregulation in cancer     128064672 (TP53)    05206 MicroRNAs in cancer     128064672 (TP53)    05205 Proteoglycans in cancer     128064672 (TP53)    05203 Viral carcinogenesis     128064672 (TP53)    05230 Central carbon metabolism in cancer     128064672 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     128064672 (TP53)    05212 Pancreatic cancer     128064672 (TP53)    05225 Hepatocellular carcinoma     128064672 (TP53)    05226 Gastric cancer     128064672 (TP53)    05214 Glioma     128064672 (TP53)    05216 Thyroid cancer     128064672 (TP53)    05220 Chronic myeloid leukemia     128064672 (TP53)    05217 Basal cell carcinoma     128064672 (TP53)    05218 Melanoma     128064672 (TP53)    05219 Bladder cancer     128064672 (TP53)    05215 Prostate cancer     128064672 (TP53)    05213 Endometrial cancer     128064672 (TP53)    05224 Breast cancer     128064672 (TP53)    05222 Small cell lung cancer     128064672 (TP53)    05223 Non-small cell lung cancer     128064672 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     128064672 (TP53)    05161 Hepatitis B     128064672 (TP53)    05160 Hepatitis C     128064672 (TP53)    05162 Measles     128064672 (TP53)    05168 Herpes simplex virus 1 infection     128064672 (TP53)    05163 Human cytomegalovirus infection     128064672 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     128064672 (TP53)    05169 Epstein-Barr virus infection     128064672 (TP53)    05165 Human papillomavirus infection     128064672 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     128064672 (TP53)    05014 Amyotrophic lateral sclerosis     128064672 (TP53)    05016 Huntington disease     128064672 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128064672 (TP53)    05418 Fluid shear stress and atherosclerosis     128064672 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     128064672 (TP53)    01522 Endocrine resistance     128064672 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:btax03000]     128064672 (TP53)    03036 Chromosome and associated proteins [BR:btax03036]     128064672 (TP53)    03400 DNA repair and recombination proteins [BR:btax03400]     128064672 (TP53) Transcription factors [BR:btax03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     128064672 (TP53) Chromosome and associated proteins [BR:btax03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      128064672 (TP53) DNA repair and recombination proteins [BR:btax03400]  Eukaryotic type   Check point factors    Other check point factors     128064672 (TP53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  128064672 NCBI-ProteinID:  XP_052513509 LinkDB All DBs Position 19:complement(27197625..27210580) Genome browser AA seq 382 aa AA seqDB search MEESQAELGVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYSEDVATWLVECPNE APQMPEPPAQAALPPATSWPLSSFVPSQKTYPGNYGFRLGFLHSGTAKSVTCTYSPSLNK LFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDGLAPP QHLIRVEGNLRAEYLDDRNTFRHSVVVPYESPEIESECTTIHYNFMCNSSCMGGMNRRPI LTIITLEDSRGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQSCPEPPPGSTKRALPSS TSSSPQQKKKPLDGEYFTLQIRGRKRFEMFRELNEALELMDAQAGREPGESRAHSSHLKS KKGPSPSCHKKPMLKREGPDSD NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt atggaagaatcgcaggcagaactcggtgtggagccccctctgagtcaggagacattttca gacttgtggaacctacttcctgaaaacaaccttctgtcctccgagctctccgcacccgtg gatgacctgctcccgtactcagaagatgttgccacctggctggttgaatgtccgaatgaa gcgccccaaatgccagagcctcctgcccaagctgccctgccaccagccacctcctggccg ctgtcgtcctttgtcccctcccagaagacctaccctggcaactacggtttccgtctcggg ttcctgcattccggaacagctaagtctgtgacctgcacgtattccccttccctcaacaag ctgttctgccagctggccaagacctgcccagtgcagctatgggtcgactcaccgcccccg cccggcacccgcgtccgcgccatggccatctacaagaagctggagcacatgacggaggtt gtgaggcgctgtccccaccatgagcgctcctctgactacagcgatggtctggccccgcct cagcaccttatccgggtggaagggaatttacgtgcggagtatttggacgaccggaacacc tttagacacagtgtggtggtgccctatgagtcccccgagattgagtctgagtgcaccacc atccactacaacttcatgtgtaacagctcctgcatggggggcatgaaccggcggcccatc ctcaccatcatcacactggaagactctcgtggtaacctgctgggacggaacagctttgag gtgcgtgtttgtgcctgtcctgggagagaccgccgcactgaggaagaaaattttcgcaag aaggggcagtcttgccccgagccaccccctgggagcactaagcgagcactgcccagcagc accagctcctctccacagcaaaagaagaaaccactggatggagaatatttcactcttcag atccgtgggcgtaaacgctttgagatgttccgagagctgaatgaggccttggagctgatg gatgctcaggctggaagggaaccaggggaaagcagggctcattctagccacctgaagtct aagaaggggccttctccttcctgccataaaaaaccaatgctcaagagagaagggcctgac tcagactga

DBGET integrated database retrieval system