Bombus vancouverensis nearcticus: 117155771 Help Entry 117155771         CDS       T07628                                  Name (RefSeq) RING-box protein 1A isoform X1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bvan  Bombus vancouverensis nearcticus Pathway bvan03420   Nucleotide excision repair bvan04120   Ubiquitin mediated proteolysis bvan04141   Protein processing in endoplasmic reticulum bvan04310   Wnt signaling pathway bvan04341   Hedgehog signaling pathway - fly bvan04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:bvan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117155771    04120 Ubiquitin mediated proteolysis     117155771   09124 Replication and repair    03420 Nucleotide excision repair     117155771  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     117155771    04341 Hedgehog signaling pathway - fly     117155771    04350 TGF-beta signaling pathway     117155771  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bvan04121]     117155771    03400 DNA repair and recombination proteins [BR:bvan03400]     117155771 Enzymes [BR:bvan01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      117155771 Ubiquitin system [BR:bvan04121]  Ubiquitin ligases (E3)   UBL E3 ligases    117155771   Multi subunit type E3    SCF complex     Ring finger protein      117155771    Cul2 complex      117155771    Cul3 complex      117155771    Cul4 complex      117155771    Cul7 complex      117155771    Cul8 complex      117155771    Cul9 complex      117155771 DNA repair and recombination proteins [BR:bvan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       117155771     TCR (transcription coupled repair) factors      Cul4-CSA complex       117155771 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  117155771 NCBI-ProteinID:  XP_033187994 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MASAMEIDDEESDLPTSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcgtcggcaatggaaattgatgatgaagaaagtgatttaccaacttcgagtagtagt aaaggagagaaaaaacgtttcgaagtaaaaaagtggaatgctgtggccctttgggcgtgg gatattgtagtagataattgcgcgatctgccgcaatcatataatggatttatgtattgaa tgtcaagcaaatcaagcgtcagctactagcgaagaatgtaccgtagcttggggtgtatgc aatcatgcattccatttccattgcatctcacgttggttgaagactcgacaagtttgtcca cttgataatcgagagtgggagttccaaaaatacggtcattag

DBGET integrated database retrieval system