Beta vulgaris (sugar beet): 104883468 Help Entry 104883468         CDS       T03548                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bvg  Beta vulgaris (sugar beet) Pathway bvg03420   Nucleotide excision repair bvg04120   Ubiquitin mediated proteolysis bvg04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bvg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104883468    04120 Ubiquitin mediated proteolysis     104883468   09124 Replication and repair    03420 Nucleotide excision repair     104883468  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bvg04121]     104883468    03400 DNA repair and recombination proteins [BR:bvg03400]     104883468 Enzymes [BR:bvg01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104883468 Ubiquitin system [BR:bvg04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104883468   Multi subunit type E3    SCF complex     Ring finger protein      104883468    Cul2 complex      104883468    Cul3 complex      104883468    Cul4 complex      104883468    Cul7 complex      104883468    Cul8 complex      104883468    Cul9 complex      104883468 DNA repair and recombination proteins [BR:bvg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104883468     TCR (transcription coupled repair) factors      Cul4-CSA complex       104883468 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  104883468 NCBI-ProteinID:  XP_010666302 UniProt:  A0A0J8B4T9 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MASTDTDVTLIPTDEGSNLAGPSPLAPTSAASKKPKRFEIKKWNAVSLWAWDIVVDNCAI CRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQ KYGH NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaaccgatacagacgtgacactgattcccaccgacgagggttcgaatcttgct ggcccatctcctttagctccaacttctgctgcttctaagaaaccgaaacgtttcgagatc aaaaaatggaacgccgtttctctttgggcttgggatattgtggttgataattgcgcgatt tgtagaaaccatatcatggatctctgcatcgagtgccaagccaaccaagcgagtgctacc agtgaggaatgtactgttgcgtggggagtctgcaatcatgcatttcatttccattgcatc agccgatggcttaaaacccgtcaagtttgtcctttagacaacagcgagtgggagttccag aagtatggccattag

DBGET integrated database retrieval system