Beta vulgaris (sugar beet): 104899743 Help Entry 104899743         CDS       T03548                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bvg  Beta vulgaris (sugar beet) Pathway bvg03420   Nucleotide excision repair bvg04120   Ubiquitin mediated proteolysis bvg04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bvg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104899743    04120 Ubiquitin mediated proteolysis     104899743   09124 Replication and repair    03420 Nucleotide excision repair     104899743  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bvg04121]     104899743    03400 DNA repair and recombination proteins [BR:bvg03400]     104899743 Enzymes [BR:bvg01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104899743 Ubiquitin system [BR:bvg04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104899743   Multi subunit type E3    SCF complex     Ring finger protein      104899743    Cul2 complex      104899743    Cul3 complex      104899743    Cul4 complex      104899743    Cul7 complex      104899743    Cul8 complex      104899743    Cul9 complex      104899743 DNA repair and recombination proteins [BR:bvg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104899743     TCR (transcription coupled repair) factors      Cul4-CSA complex       104899743 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  104899743 NCBI-ProteinID:  XP_010685302 LinkDB All DBs Position 7:36420655..36423395 Genome browser AA seq 113 aa AA seqDB search MDTDVVMVPAGEGSSTGGPSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatacagacgttgttatggttcccgccggcgagggttcgagcaccggtggcccctct tccaaaaaacccaaacgttttgagatcaaaaagtggaacgccgtctctctttgggcctgg gatattgttgtcgacaattgcgcaatctgtcgtaatcatattatggatctatgtattgaa tgccaagctaatcaagcgagcgctacgagtgaggagtgcactgttgcttggggtgtttgc aaccatgccttccatttccactgcatcagccgttggttgaaaacccgacaagtctgtcca ttagataatagtgagtgggagtttcagaaatatggtcattag

DBGET integrated database retrieval system