Bacillus mycoides WSBC 10204: bwei_1253 Help Entry bwei_1253         CDS       T03453                                  Symbol hfq2 Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bww  Bacillus mycoides WSBC 10204 Pathway bww02024   Quorum sensing bww03018   RNA degradation Brite KEGG Orthology (KO) [BR:bww00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     bwei_1253 (hfq2)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     bwei_1253 (hfq2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bww03019]     bwei_1253 (hfq2)    03036 Chromosome and associated proteins [BR:bww03036]     bwei_1253 (hfq2) Messenger RNA biogenesis [BR:bww03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      bwei_1253 (hfq2) Chromosome and associated proteins [BR:bww03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     bwei_1253 (hfq2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AIW83909 UniProt:  A0A084J4H8 LinkDB All DBs Position 1147727..1147951 Genome browser AA seq 74 aa AA seqDB search MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAI STFVPQKNVSIELE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaagcaatcaatcaatattcaagatcagtttttaaatcaactccgtaaagagaatacg ttcgttacgctgtacttattaaatggtttccagcttcgtggattaattaaaggatttgat aattttacagtcctgctggaaacagaaggtaagcaacagcttatttataaacatgcaatt tctacatttgtaccacaaaaaaatgtttcaattgaattagagtag

DBGET integrated database retrieval system