Bacillus amyloliquefaciens XH7: BAXH7_00083 Help Entry BAXH7_00083       CDS       T01836                                  Symbol folA Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bxh  Bacillus amyloliquefaciens XH7 Pathway bxh00790   Folate biosynthesis bxh01100   Metabolic pathways bxh01240   Biosynthesis of cofactors Module bxh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bxh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BAXH7_00083 (folA) Enzymes [BR:bxh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BAXH7_00083 (folA)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BAXH7_00083 (folA)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BAXH7_00083 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AEK87236 LinkDB All DBs Position 82749..83111 Genome browser AA seq 120 aa AA seqDB search MDKVYVEGMEFYGYHGVFEEENKLGQRFKVDLTAELDLSKAGQTDDLSYTINYAELYSVC RGIVEGEPVNLVETLAERIADTVLKKFEPVQQCTVKVIKPDPPIPGHYKSVAIEMTRKKS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggataaagtatatgtagaaggtatggagttttacggatatcacggcgtgttcgaagaa gaaaataaactcggtcagcgtttcaaagtagacctgactgccgagctggatttgagcaaa gcgggacaaacggatgacctttcttataccattaattatgcggagctttacagtgtctgc cgcggcatcgttgagggcgagcccgtcaatttggtcgagacgcttgcggaacggatcgca gacacggttcttaagaaatttgagcctgtgcagcaatgtacggtaaaggttattaagcct gatccgccgattcccggccattataaatcagtagccatagaaatgacgagaaagaaatca tga

DBGET integrated database retrieval system