Bacillus velezensis YAU B9601-Y2: BANAU_2102 Help Entry BANAU_2102        CDS       T02050                                  Symbol dfrA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism bya  Bacillus velezensis YAU B9601-Y2 Pathway bya00670   One carbon pool by folate bya00790   Folate biosynthesis bya01100   Metabolic pathways bya01240   Biosynthesis of cofactors bya04981   Folate transport and metabolism Module bya_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bya00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BANAU_2102 (dfrA)    00670 One carbon pool by folate     BANAU_2102 (dfrA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     BANAU_2102 (dfrA) Enzymes [BR:bya01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      BANAU_2102 (dfrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  CCG50123 UniProt:  I2C6M7 LinkDB All DBs Position complement(2300928..2301413) Genome browser AA seq 161 aa AA seqDB search MISFIFAMDENRLIGKDNDLPWHLPDDLAYFKKVTTGHTIVMGRKTFESIGRPLPNRRNI VVTSRDESLFPGCITADSAEEVLKLIPPDEECFVIGGAQLYSALFPYADRLYMTKIHHVF EGDRFFPEFNEAEWELTSRKQGVKDEKNPYDYEYLVYEKKN NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgatttcgtttatttttgcgatggatgaaaaccggctgatcggaaaagataacgatctg ccttggcaccttcccgatgatctcgcatatttcaaaaaagtgacgacgggtcacaccatt gtaatggggcggaaaacgtttgaatcaatcggacgcccgcttccgaaccggcgtaacatc gttgtaacctcacgggacgaatctttattcccgggctgtattaccgccgactcggctgag gaagtgctcaagctgatcccgcccgatgaagaatgctttgtgatcggcggcgcccagctg tacagtgcgctctttccttatgcggacaggctctacatgacaaaaattcaccatgtcttt gaaggagaccgtttttttccggaatttaatgaagctgaatgggaattgacatcccgcaaa cagggagtaaaagatgaaaaaaacccttacgattatgagtaccttgtatacgagaaaaag aattga

DBGET integrated database retrieval system