Bipolaris zeicola: COCCADRAFT_95811 Help Entry COCCADRAFT_95811  CDS       T03110                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bze  Bipolaris zeicola Pathway bze03420   Nucleotide excision repair bze04111   Cell cycle - yeast bze04120   Ubiquitin mediated proteolysis bze04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bze00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     COCCADRAFT_95811    04120 Ubiquitin mediated proteolysis     COCCADRAFT_95811   09124 Replication and repair    03420 Nucleotide excision repair     COCCADRAFT_95811  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     COCCADRAFT_95811  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bze04121]     COCCADRAFT_95811    03400 DNA repair and recombination proteins [BR:bze03400]     COCCADRAFT_95811 Enzymes [BR:bze01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      COCCADRAFT_95811 Ubiquitin system [BR:bze04121]  Ubiquitin ligases (E3)   UBL E3 ligases    COCCADRAFT_95811   Multi subunit type E3    SCF complex     Ring finger protein      COCCADRAFT_95811    Cul2 complex      COCCADRAFT_95811    Cul3 complex      COCCADRAFT_95811    Cul4 complex      COCCADRAFT_95811    Cul7 complex      COCCADRAFT_95811    Cul8 complex      COCCADRAFT_95811    Cul9 complex      COCCADRAFT_95811 DNA repair and recombination proteins [BR:bze03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       COCCADRAFT_95811     TCR (transcription coupled repair) factors      Cul4-CSA complex       COCCADRAFT_95811 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  19154023 NCBI-ProteinID:  XP_007712176 JGI:  95811 UniProt:  W6Y7S7 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MADAPPAKTKTSKAGASGEGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQ ANQASATSEECTVAWGICNHAFHFHCISRWLKTRQVCPLDNRDWEFQKYGR NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggcagacgcgcccccggccaagaccaagacatccaaggccggtgccagtggagagggc gacaagaagcgcttcgaggtcaagaagtggaatgccgttgctctctgggcctgggatatc gtcgtcgacaactgtgccatttgccgcaaccacatcatggacctgtgcattgagtgccag gccaaccaagcttcggcaactagcgaagagtgcacggtagcctggggtatctgcaatcac gccttccacttccactgcatttcacgatggctcaagacgcgacaggtctgcccgctcgac aacagagactgggagttccaaaagtacggccgatag

DBGET integrated database retrieval system