KEGG   Candidatus Cloacimonas acidaminovorans: CLOAM0809
Entry
CLOAM0809         CDS       T04769                                 
Name
(GenBank) putative Glutamate-1-semialdehyde 2,1-aminomutase (GSA) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT)
  KO
K21585  3-aminobutanoyl-CoA transaminase [EC:2.6.1.111]
Organism
caci  Candidatus Cloacimonas acidaminovorans
Brite
KEGG Orthology (KO) [BR:caci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CLOAM0809
Enzymes [BR:caci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.111  3-aminobutanoyl-CoA transaminase
     CLOAM0809
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: CAO80691
UniProt: B0VH76
LinkDB
Position
complement(932859..934103)
AA seq 414 aa
MAEKLKLARSMSLFEEAKQLVPGGVAGIRRPYNFVPGEYPIFFDHGKGGRVVDVDGNEYI
DFLCAYGPIIIGYREDEIDDAVINQIKNKGFCFSLTQEMQNTLVKKLRELIPCCEMAALV
KTGSDATTIAIRVARGYTGKTKIARYGYHGWHDWCVEVKGGIPPKLYEDIYEFHYNDLDS
LKAILEANKDDMAGIIITPIGHPNGAEVQMPKPGYLEAVRELANQYHCLLIFDEIRSGFR
CSLGGAQKLFGVTPDLSTFGKAMANGYAIAALVGKEEYMQVLADKVFLSSTFFPNSDGIV
AAIKTIEILERDRILDVVAAKGRKFGAEVEKVVEESGVPVNFTGAPWMPYITFKKDEAGL
YKKLRTEYYTQLIRHNVFMQPYHHGYICYRHTDEDLAYTVEAIRESLAEVKKML
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcagaaaaattgaaattagccagaagtatgtctctttttgaagaggcaaagcaactt
gttcccggaggcgttgccgggataagaaggccctacaattttgttccgggtgaatatccc
attttctttgatcacggaaagggcggcagagttgttgatgtggacggtaacgaatacatt
gactttctttgtgcttacggacctattattattggttaccgtgaagatgaaattgatgat
gctgttatcaatcagattaagaacaagggtttttgtttttccctaacgcaggaaatgcaa
aacactttggtgaaaaagctgagagaactgataccctgttgtgaaatggctgctttagta
aaaacaggcagtgatgctacaactattgctattcgtgtggcgcgcggttatacaggcaaa
actaaaatagcgcgttacggttatcatggctggcacgattggtgcgtagaagtgaaaggt
ggaattcctcctaagttgtatgaagatatttatgaatttcattacaacgatttggattcc
ctaaaagcaattctggaagccaataaagatgatatggcaggaataattattactcctatt
ggccatcctaatggagcggaagtccaaatgccgaaaccgggttatctggaagcagtgcgt
gaattggcaaatcaatatcactgtttgttaatttttgatgaaatccgcagtggtttccgt
tgcagtttaggaggagcgcaaaaattatttggggtaacacctgatttatccactttcgga
aaagcaatggcaaatggttatgctattgcagctttagtaggaaaagaggaatatatgcag
gtcttggcagataaggtatttctgtcctcaacctttttccccaatagcgatggcatcgta
gcagctataaaaaccatagaaattttggaaagagaccgtattttggatgtagttgccgca
aaaggaagaaagtttggagcggaagtagaaaaagtagtggaggaatcaggagtgcctgtt
aattttaccggagctccctggatgccttatataacctttaaaaaggatgaggcggggctt
tataaaaagttgcggacagaatattatacccagttaattaggcacaatgtttttatgcag
ccctatcatcatggctatatttgttatcggcatacggatgaggatttggcatacacggtg
gaagcaattagagaatcccttgccgaagtgaaaaagatgttataa

DBGET integrated database retrieval system