Candidatus Cloacimonas acidaminovorans: CLOAM1093 Help Entry CLOAM1093         CDS       T04769                                  Symbol folA Name (GenBank) Dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism caci  Candidatus Cloacimonas acidaminovorans Pathway caci00670   One carbon pool by folate caci00790   Folate biosynthesis caci01100   Metabolic pathways caci01240   Biosynthesis of cofactors caci04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:caci00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CLOAM1093 (folA)    00670 One carbon pool by folate     CLOAM1093 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CLOAM1093 (folA) Enzymes [BR:caci01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CLOAM1093 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  CAO80956 UniProt:  B0VHY5 LinkDB All DBs Position complement(1283466..1283891) Genome browser AA seq 141 aa AA seqDB search MPWKITEDLKRFKAITMGHPVIMGKNTWNSIGKPLPGRQNIVLSKDRNFQPQGAIVAHSL EEALKMVEGQEAYIIGGASVFKQFLPLADKMLITLIHSEFEGDTYFPYFSEEDWILQESS SLLSSSGYELCLQIYIRKNLL NT seq 426 nt NT seq  +upstreamnt  +downstreamnt ttgccctggaaaattaccgaagaccttaaaagatttaaagctataacaatggggcatccc gttattatgggaaaaaatacctggaattcaatcggaaaaccattgcccggaagacagaat atcgtgctgagcaaagaccgaaactttcaaccccaaggtgctattgttgctcatagtttg gaggaagcattaaaaatggtggaaggacaagaggcatatattatcggtggagcaagtgtg ttcaagcaatttttacccctggctgataagatgctgataactcttatccattccgaattt gaaggcgacacctattttccttatttttcggaagaggattggattttgcaggaaagttcc tctctgctttcttcttccggctatgaattatgtcttcaaatctatatcaggaaaaatctc ctctaa

DBGET integrated database retrieval system