Cicer arietinum (chickpea): 101491483 Help Entry 101491483         CDS       T02819                                  Name (RefSeq) uncharacterized protein   KO K26502   transmembrane protein 258 Organism cam  Cicer arietinum (chickpea) Pathway cam00510   N-Glycan biosynthesis cam00513   Various types of N-glycan biosynthesis cam04141   Protein processing in endoplasmic reticulum Module cam_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cam00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     101491483    00513 Various types of N-glycan biosynthesis     101491483  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101491483 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  101491483 NCBI-ProteinID:  XP_004507932 UniProt:  A0A1S2YPI9 LinkDB All DBs Position 7:complement(2904495..2907023) Genome browser AA seq 76 aa AA seqDB search MAPKAIASPIPDSLYPTLSIINLAIGLILTASFFIYEATSSRKTRSLAQELTTGAVASVF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccaaaagcgatcgcgagtcctatccctgattcactgtaccccacactctccatc atcaacctcgccatcggtctcatcttaaccgcttctttcttcatttatgaagcaacctct tctaggaaaacccgttcccttgctcaggagctgacaacgggagcagttgcatcagtcttc ttgggttttgggtccttgttcctcttacttgcctccggcgtttatgtctaa

DBGET integrated database retrieval system