Corynebacterium ammoniagenes: CAMM_09320
Help
Entry
CAMM_09320 CDS
T05164
Name
(GenBank) short-chain dehydrogenase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
camg
Corynebacterium ammoniagenes
Pathway
camg00061
Fatty acid biosynthesis
camg00780
Biotin metabolism
camg01100
Metabolic pathways
camg01110
Biosynthesis of secondary metabolites
camg01212
Fatty acid metabolism
camg01240
Biosynthesis of cofactors
Module
camg_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
camg00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
CAMM_09320
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
CAMM_09320
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
CAMM_09320
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
camg01004
]
CAMM_09320
Enzymes [BR:
camg01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
CAMM_09320
Lipid biosynthesis proteins [BR:
camg01004
]
Fatty acid synthase
Component type
CAMM_09320
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
SDR
Motif
Other DBs
NCBI-ProteinID:
APT83105
UniProt:
A0ABN0AGP5
LinkDB
All DBs
Position
complement(2024568..2025350)
Genome browser
AA seq
260 aa
AA seq
DB search
MLTRDDGLEGKVALISGGSSGIGASLAVLYAKAGCDSVISYIESDGHDPQEVVKAVEAEG
RRCIAVACDVSSAEEVDNFAQVAIDEFGRLDIAVAMAGILRKASLEEMTDERFNDMLDID
LVGVLRLFRSAAARMNNGGAMVAASSIAGGHYGWGEHLHYAAAKSGLQGLCRSLAVELAP
RQIRVNTIIPGLIESPQSLDGQNSLGKEGLEAASSYIPWGRVGTTEECARAIRFLTSDDS
SFVTGQQLIVDGGQTVRWPS
NT seq
783 nt
NT seq
+upstream
nt +downstream
nt
ttgttaactcgtgacgatggactcgaaggaaaagtcgctttaatctccggcggcagcagc
ggtatcggtgcttctttggcagtactgtatgccaaggccggatgcgacagcgtgatttcc
tatattgaatcggatggacatgatccacaagaagtggtcaaagcagtcgaagcagaagga
cgtcgctgcatcgcggtggcctgtgatgtttcttcggctgaagaagtcgataacttcgct
caggtagctatcgatgaattcggacgccttgatattgcagtggccatggccggaatcttg
cgcaaggcatcactggaagagatgacggatgagcgtttcaacgacatgctcgatatcgac
ttggtcggtgttttgcgtttgttccgctcggctgccgcgcgcatgaacaacggcggagcc
atggtggcggcctcctcaattgctggtggacactatggctggggcgaacaccttcactac
gccgcagcaaaatccggcctgcagggcctatgccgctcccttgcggtggagcttgctcct
cgccagatccgcgtcaacaccatcatccctgggctgatcgaaagcccacagtcgttggac
ggacaaaactcactcggcaaagagggcttggaagcagccagcagctacatcccatggggg
cgtgtgggcaccacggaagaatgcgcacgcgctatccgtttcctgacctctgatgactcg
tcctttgtcaccggccagcagttgatcgtcgatggtggccagaccgtgcgctggccaagc
taa
DBGET
integrated database retrieval system