Caproicibacterium amylolyticum: H6X83_01115
Help
Entry
H6X83_01115 CDS
T07171
Symbol
ilvB
Name
(GenBank) biosynthetic-type acetolactate synthase large subunit
KO
K01652
acetolactate synthase I/II/III large subunit [EC:
2.2.1.6
]
Organism
caml
Caproicibacterium amylolyticum
Pathway
caml00290
Valine, leucine and isoleucine biosynthesis
caml00650
Butanoate metabolism
caml00660
C5-Branched dibasic acid metabolism
caml00770
Pantothenate and CoA biosynthesis
caml01100
Metabolic pathways
caml01110
Biosynthesis of secondary metabolites
caml01210
2-Oxocarboxylic acid metabolism
caml01230
Biosynthesis of amino acids
Module
caml_M00019
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
caml_M00570
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:
caml00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00650 Butanoate metabolism
H6X83_01115 (ilvB)
00660 C5-Branched dibasic acid metabolism
H6X83_01115 (ilvB)
09105 Amino acid metabolism
00290 Valine, leucine and isoleucine biosynthesis
H6X83_01115 (ilvB)
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
H6X83_01115 (ilvB)
Enzymes [BR:
caml01000
]
2. Transferases
2.2 Transferring aldehyde or ketonic groups
2.2.1 Transketolases and transaldolases
2.2.1.6 acetolactate synthase
H6X83_01115 (ilvB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TPP_enzyme_C
TPP_enzyme_M
TPP_enzyme_N
POR_N
Motif
Other DBs
NCBI-ProteinID:
QNO18296
UniProt:
A0A7G9WHY4
LinkDB
All DBs
Position
260195..261859
Genome browser
AA seq
554 aa
AA seq
DB search
MLLTGAQIIMECLLEQKVDTVFGYPGGAVLNIYDALYEYRDRINHVRTAHEQGAAHAADG
YARSTGKAGVCIATSGPGATNLVTGIATAYMDSVPVVAITGNVNVDLLGLDSFQEVDITG
ITMPITKHNFLVKHIEDLADVLRQAFQIAQSGRPGPVLVDIPKDLTAKKYEYQKQAPLPL
LPVHYPSDEHLRQAAQMLQNSRQPFLYLGGGVSLSGADKEAAAFAEKLDAPVSASLMAQG
AFDAHNSRYMGMLGMHGTKTSAEAIKNCDLFVAVGTRFSDRVLCNAGLFARNCPILQIDI
DAAEFNKNIDVDLRLEGDARQVLTGLLSLLPQQNHAAWMEQVHAWQKAYPLTQAAEAGVL
PKDVLETLDKLTDSNAILTTEVGQHQMWAAQFYKFRRPRQFLTSGGLGTMGYGLGAALGA
QAGNPKAKVINVAGDGGLHMNCNELATVAHYSLPVVELLLNNSVLGMVRQWQKLFYDNRF
SQTTLDTNTDFCKLAEAFGVKAYRIKTKEEIEPTLKEALAQQGPVLVDCWVDKDVNVLPM
VPAGASVEDPMLEM
NT seq
1665 nt
NT seq
+upstream
nt +downstream
nt
atgttactgactggtgcacaaattatcatggagtgcctgctggagcagaaagtggatacg
gttttcggctatccgggcggggcagtgctgaatatttatgacgcactgtatgaatatcgg
gaccgcatcaatcatgtgcgcacggcacatgagcagggcgcggcccacgcagcggacggc
tacgcgcgctctaccggaaaagctggtgtctgcattgctacttccggccctggtgccacc
aatctggttactggcattgcaactgcttatatggacagcgtgccggtcgtggcaattacc
ggcaatgtaaatgtggatttactaggcttggattcctttcaggaagtggacattaccggc
attaccatgccgattacgaagcataatttccttgtcaagcatatcgaggaccttgcggat
gttctgcggcaggcgtttcagattgcgcagtccggcaggcccggcccggtgctggtggat
atcccgaaggacctgaccgccaaaaagtatgagtaccagaagcaggcaccgctgccgctg
ctgccggtgcattatccctcggatgaacacctgcggcaggcggcgcagatgctgcagaac
agcaggcagccgttcctgtatctgggcggcggtgtttccctttccggcgcggataaggaa
gcagccgcgtttgcggaaaagctggacgccccggtcagtgcgtcgctgatggcgcagggt
gcgtttgatgcgcacaattcccgttatatgggcatgcttggcatgcacggcaccaaaacg
agcgcggaagccattaaaaactgcgatttgtttgtggcggtaggcacccgcttttctgac
cgtgtgctgtgtaacgcggggctgtttgcacgcaactgcccgattttgcagatcgatatt
gacgcggcggaattcaataaaaatattgatgtggacctgcggctggagggtgatgcccgt
caggtgctgaccggcctgctttccctgctgccgcagcagaaccatgccgcgtggatggag
caggtgcatgcgtggcagaaagcatatccgctgacgcaggccgccgaagcgggcgtgctg
cccaaagatgtgctggaaacgctggataagctgacagactccaatgcaattttgaccacc
gaagtcggtcagcaccagatgtgggcggcgcagttctacaaattccgccggccgcggcag
ttcctgacctccggcggattaggtaccatggggtacggcctcggcgcggcgctgggtgca
caggcaggcaatccaaaagcaaaagtcatcaatgtcgccggggacggcggcctgcacatg
aactgcaacgagcttgccacagtggcacattacagcctgccggtcgtggaactgctgctg
aacaattccgtgctgggcatggtgcggcagtggcagaagcttttttacgacaaccgtttt
tcccagacaacattggacaccaacaccgatttctgcaagttggcggaggcgtttggtgtg
aaagcataccgcattaaaacaaaagaggaaatcgagccgacgctgaaagaagcgctggca
cagcaggggccggtgctggtagactgctgggtagataaagatgtaaacgtgctgccgatg
gttcccgcaggcgccagcgtggaagacccgatgctggaaatgtga
DBGET
integrated database retrieval system