Caproicibacterium amylolyticum: H6X83_01185 Help Entry H6X83_01185       CDS       T07171                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism caml  Caproicibacterium amylolyticum Pathway caml01100   Metabolic pathways caml01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caml00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H6X83_01185 (acpP)    00074 Mycolic acid biosynthesis     H6X83_01185 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H6X83_01185 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QNO18309 UniProt:  A0A7G9WHZ7 LinkDB All DBs Position 275904..276131 Genome browser AA seq 75 aa AA seqDB search MVLEKVKHILAEQFDVEEDNITAEMSIADDLGADSLDVVDLLMSIEDEFEIEVPDGEVDN IKTVGDLVNYIEEHM NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggtactggaaaaagtcaagcacattcttgctgagcagtttgatgtggaagaagacaac atcactgccgagatgagcattgccgatgatctgggcgccgattcactggatgtggtcgat ttgctgatgtccatcgaagacgaatttgagattgaagtcccggatggggaggttgacaat atcaaaaccgtcggagatctggtcaattatattgaagagcatatgtaa

DBGET integrated database retrieval system