Capsicum annuum (peppers): 107840900 Help Entry 107840900         CDS       T04646                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cann  Capsicum annuum (peppers) Pathway cann03420   Nucleotide excision repair cann04120   Ubiquitin mediated proteolysis cann04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cann00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107840900    04120 Ubiquitin mediated proteolysis     107840900   09124 Replication and repair    03420 Nucleotide excision repair     107840900  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cann04121]     107840900    03400 DNA repair and recombination proteins [BR:cann03400]     107840900 Enzymes [BR:cann01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107840900 Ubiquitin system [BR:cann04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107840900   Multi subunit type E3    SCF complex     Ring finger protein      107840900    Cul2 complex      107840900    Cul3 complex      107840900    Cul4 complex      107840900    Cul7 complex      107840900    Cul8 complex      107840900    Cul9 complex      107840900 DNA repair and recombination proteins [BR:cann03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107840900     TCR (transcription coupled repair) factors      Cul4-CSA complex       107840900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  107840900 NCBI-ProteinID:  XP_016540332 UniProt:  A0A1U8DZ86 LinkDB All DBs Position 9:217052587..217057259 Genome browser AA seq 116 aa AA seqDB search MASPDTDVPMVPAGEGSTGAGTSTKKAKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaccggataccgatgttccgatggttcccgccggcgaaggttctaccggagct ggaacatctactaaaaaggcgaagcgatttgagatcaaaaagtggaatgctgtttcgctt tgggcttgggatattgtggtagataattgtgccatctgtaggaatcacatcatggatctc tgtatcgagtgtcaagctaatcaagctagcgcaacaagtgaggaatgcacagttgcttgg ggggtttgtaaccatgcattccacttccattgcatcagtaggtggctcaagactcgtcaa gtatgccctcttgataacagcgagtgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system