Coffea arabica (coffee): 113691765 Help Entry 113691765         CDS       T11342                                  Name (RefSeq) uncharacterized protein   KO K26502   transmembrane protein 258 Organism carb  Coffea arabica (coffee) Pathway carb00510   N-Glycan biosynthesis carb00513   Various types of N-glycan biosynthesis carb04141   Protein processing in endoplasmic reticulum Module carb_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:carb00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     113691765    00513 Various types of N-glycan biosynthesis     113691765  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113691765 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  113691765 NCBI-ProteinID:  XP_027065861 UniProt:  A0A6P6SJ61 LinkDB All DBs Position 6c Genome browser AA seq 78 aa AA seqDB search MAQSVKPISSPVPEPWYPTLAVLMLAVGLIVAASFFIYEATSSKKNRSLAKELTTGAVAS VFLGFGSLFLLLACGIYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctcaatcagtgaagccgatctcgagcccagtcccggagccgtggtacccaaccctg gccgtcctaatgctcgccgttggcctgatcgtcgctgcgtcctttttcatttatgaagct acctcttcaaagaagaatcgtagtcttgctaaggagctcactactggggcagtggcatct gtcttcttgggttttggatcgttgttcttgctacttgcttgtgggatttatgtttga

DBGET integrated database retrieval system