Cercocebus atys (sooty mangabey): 105573465 Help Entry 105573465         CDS       T07242                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty01523   Antifolate resistance caty04010   MAPK signaling pathway caty04060   Cytokine-cytokine receptor interaction caty04061   Viral protein interaction with cytokine and cytokine receptor caty04064   NF-kappa B signaling pathway caty04071   Sphingolipid signaling pathway caty04150   mTOR signaling pathway caty04210   Apoptosis caty04217   Necroptosis caty04350   TGF-beta signaling pathway caty04380   Osteoclast differentiation caty04612   Antigen processing and presentation caty04620   Toll-like receptor signaling pathway caty04621   NOD-like receptor signaling pathway caty04622   RIG-I-like receptor signaling pathway caty04625   C-type lectin receptor signaling pathway caty04640   Hematopoietic cell lineage caty04650   Natural killer cell mediated cytotoxicity caty04657   IL-17 signaling pathway caty04660   T cell receptor signaling pathway caty04664   Fc epsilon RI signaling pathway caty04668   TNF signaling pathway caty04920   Adipocytokine signaling pathway caty04930   Type II diabetes mellitus caty04931   Insulin resistance caty04932   Non-alcoholic fatty liver disease caty04933   AGE-RAGE signaling pathway in diabetic complications caty04936   Alcoholic liver disease caty04940   Type I diabetes mellitus caty05010   Alzheimer disease caty05014   Amyotrophic lateral sclerosis caty05020   Prion disease caty05022   Pathways of neurodegeneration - multiple diseases caty05132   Salmonella infection caty05133   Pertussis caty05134   Legionellosis caty05135   Yersinia infection caty05140   Leishmaniasis caty05142   Chagas disease caty05143   African trypanosomiasis caty05144   Malaria caty05145   Toxoplasmosis caty05146   Amoebiasis caty05152   Tuberculosis caty05160   Hepatitis C caty05161   Hepatitis B caty05163   Human cytomegalovirus infection caty05164   Influenza A caty05165   Human papillomavirus infection caty05166   Human T-cell leukemia virus 1 infection caty05168   Herpes simplex virus 1 infection caty05169   Epstein-Barr virus infection caty05170   Human immunodeficiency virus 1 infection caty05171   Coronavirus disease - COVID-19 caty05205   Proteoglycans in cancer caty05310   Asthma caty05321   Inflammatory bowel disease caty05322   Systemic lupus erythematosus caty05323   Rheumatoid arthritis caty05330   Allograft rejection caty05332   Graft-versus-host disease caty05410   Hypertrophic cardiomyopathy caty05414   Dilated cardiomyopathy caty05417   Lipid and atherosclerosis caty05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105573465 (TNF)    04350 TGF-beta signaling pathway     105573465 (TNF)    04064 NF-kappa B signaling pathway     105573465 (TNF)    04668 TNF signaling pathway     105573465 (TNF)    04071 Sphingolipid signaling pathway     105573465 (TNF)    04150 mTOR signaling pathway     105573465 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105573465 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     105573465 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105573465 (TNF)    04217 Necroptosis     105573465 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105573465 (TNF)    04620 Toll-like receptor signaling pathway     105573465 (TNF)    04621 NOD-like receptor signaling pathway     105573465 (TNF)    04622 RIG-I-like receptor signaling pathway     105573465 (TNF)    04625 C-type lectin receptor signaling pathway     105573465 (TNF)    04650 Natural killer cell mediated cytotoxicity     105573465 (TNF)    04612 Antigen processing and presentation     105573465 (TNF)    04660 T cell receptor signaling pathway     105573465 (TNF)    04657 IL-17 signaling pathway     105573465 (TNF)    04664 Fc epsilon RI signaling pathway     105573465 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     105573465 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     105573465 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105573465 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105573465 (TNF)    05170 Human immunodeficiency virus 1 infection     105573465 (TNF)    05161 Hepatitis B     105573465 (TNF)    05160 Hepatitis C     105573465 (TNF)    05171 Coronavirus disease - COVID-19     105573465 (TNF)    05164 Influenza A     105573465 (TNF)    05168 Herpes simplex virus 1 infection     105573465 (TNF)    05163 Human cytomegalovirus infection     105573465 (TNF)    05169 Epstein-Barr virus infection     105573465 (TNF)    05165 Human papillomavirus infection     105573465 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     105573465 (TNF)    05135 Yersinia infection     105573465 (TNF)    05133 Pertussis     105573465 (TNF)    05134 Legionellosis     105573465 (TNF)    05152 Tuberculosis     105573465 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     105573465 (TNF)    05144 Malaria     105573465 (TNF)    05145 Toxoplasmosis     105573465 (TNF)    05140 Leishmaniasis     105573465 (TNF)    05142 Chagas disease     105573465 (TNF)    05143 African trypanosomiasis     105573465 (TNF)   09163 Immune disease    05310 Asthma     105573465 (TNF)    05322 Systemic lupus erythematosus     105573465 (TNF)    05323 Rheumatoid arthritis     105573465 (TNF)    05321 Inflammatory bowel disease     105573465 (TNF)    05330 Allograft rejection     105573465 (TNF)    05332 Graft-versus-host disease     105573465 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     105573465 (TNF)    05014 Amyotrophic lateral sclerosis     105573465 (TNF)    05020 Prion disease     105573465 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     105573465 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105573465 (TNF)    05418 Fluid shear stress and atherosclerosis     105573465 (TNF)    05410 Hypertrophic cardiomyopathy     105573465 (TNF)    05414 Dilated cardiomyopathy     105573465 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     105573465 (TNF)    04940 Type I diabetes mellitus     105573465 (TNF)    04936 Alcoholic liver disease     105573465 (TNF)    04932 Non-alcoholic fatty liver disease     105573465 (TNF)    04931 Insulin resistance     105573465 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     105573465 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     105573465 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105573465 (TNF)    00536 Glycosaminoglycan binding proteins [BR:caty00536]     105573465 (TNF) Cytokines and neuropeptides [BR:caty04052]  Cytokines   Tumor necrosis fators    105573465 (TNF) Glycosaminoglycan binding proteins [BR:caty00536]  Heparan sulfate / Heparin   Cytokines    105573465 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  105573465 NCBI-ProteinID:  XP_011888419 Ensembl:  ENSCATG00000005167 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALPRKTAGPQGSRRCWFLSLFSFLLVAGATTLFCLLHFGVIGPQR EEFPKDPSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELT DNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcacggaaagcatgatccgggacgtggagctggccgaggaggcgctccccaggaag acagcggggccccagggctccaggcggtgctggttcctcagcctcttctccttcctgctc gtggcaggcgccaccacgctcttctgtctgctgcactttggagtgatcggcccccagagg gaagagttccccaaggacccctctctaatcagccctctggcccaggcagtcagatcatct tctcgaaccccaagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtagagctgaca gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc aagggccaaggctgcccctccaaccatgtgctcctcacccacaccatcagccgcatcgct gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag actccagagggggctgaggccaagccctggtatgagcccatctacctaggaggggtcttt cagctggagaagggtgatcgactcagcgctgagatcaatctgcccgactatctcgacttt gccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system