Cercocebus atys (sooty mangabey): 105577576 Help Entry 105577576         CDS       T07242                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty00510   N-Glycan biosynthesis caty00513   Various types of N-glycan biosynthesis caty04141   Protein processing in endoplasmic reticulum Module caty_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:caty00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     105577576 (TMEM258)    00513 Various types of N-glycan biosynthesis     105577576 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105577576 (TMEM258) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  105577576 NCBI-ProteinID:  XP_011897494 Ensembl:  ENSCATG00000044378 UniProt:  A0A2K5P1S1 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaacccggctgtcttcccccat ctgaccgtggtgcttttggccatcggcatgttcttcaccgcctggttcttcgtttacgag gtcacctctaccaagtacactcgtgatatctataaagagctcctcatctctttggtggcc tcactcttcatgggctttggagtccttttcctgctgctctgggttggcatctacgtgtga

DBGET integrated database retrieval system