Cercocebus atys (sooty mangabey): 105580855 Help Entry 105580855         CDS       T07242                                  Symbol NPPA Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04022   cGMP-PKG signaling pathway caty04024   cAMP signaling pathway caty04066   HIF-1 signaling pathway caty04081   Hormone signaling caty04270   Vascular smooth muscle contraction caty04714   Thermogenesis caty04921   Oxytocin signaling pathway caty04923   Regulation of lipolysis in adipocytes caty04924   Renin secretion caty04925   Aldosterone synthesis and secretion caty05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     105580855 (NPPA)    04024 cAMP signaling pathway     105580855 (NPPA)    04022 cGMP-PKG signaling pathway     105580855 (NPPA)   09133 Signaling molecules and interaction    04081 Hormone signaling     105580855 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     105580855 (NPPA)    04921 Oxytocin signaling pathway     105580855 (NPPA)    04924 Renin secretion     105580855 (NPPA)    04925 Aldosterone synthesis and secretion     105580855 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     105580855 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     105580855 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     105580855 (NPPA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105580855 (NPPA) Cytokines and neuropeptides [BR:caty04052]  Neuropeptides   Unclassified    105580855 (NPPA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  105580855 NCBI-ProteinID:  XP_011904721 Ensembl:  ENSCATG00000006882 UniProt:  A0A2K5KLB1 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MSSFSTISVSFLLFLAFQLPGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP QVLREQNEEAGAALSPLPEVPPWTGDVSPAQRDGGALGQGPWDSSDRSALLKSKLRALLT APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgagctccttctccaccatcagcgtgagcttcctcctttttctggcattccagctccca ggtcagaccagagctaatcccatgtacaatgccgtgtccaacgcagacctgatggatttc aagaatttgctggaccatttggaagaaaagatgcctttagaagatgaggtcgtgccccca caagtgctcagagagcagaatgaagaagcgggggctgctctcagccccctccctgaggtg cctccctggactggggatgtcagcccagcccagagagatgggggtgccctcgggcagggc ccctgggactcctccgatcgatctgccctcttaaaaagcaagctgagggcgctgctcact gcccctcggagcctgcggagatccagctgcttcgggggcaggatggacaggattggagcc cagagcggactgggctgtaacagcttccggtaccgaagataa

DBGET integrated database retrieval system