Cercocebus atys (sooty mangabey): 105596235 Help Entry 105596235         CDS       T07242                                  Symbol CXCL1 Name (RefSeq) growth-regulated alpha protein   KO K05505   C-X-C motif chemokine 1/2/3 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04060   Cytokine-cytokine receptor interaction caty04061   Viral protein interaction with cytokine and cytokine receptor caty04062   Chemokine signaling pathway caty04064   NF-kappa B signaling pathway caty04621   NOD-like receptor signaling pathway caty04657   IL-17 signaling pathway caty04668   TNF signaling pathway caty04936   Alcoholic liver disease caty05134   Legionellosis caty05146   Amoebiasis caty05167   Kaposi sarcoma-associated herpesvirus infection caty05323   Rheumatoid arthritis caty05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105596235 (CXCL1)    04668 TNF signaling pathway     105596235 (CXCL1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105596235 (CXCL1)    04061 Viral protein interaction with cytokine and cytokine receptor     105596235 (CXCL1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105596235 (CXCL1)    04657 IL-17 signaling pathway     105596235 (CXCL1)    04062 Chemokine signaling pathway     105596235 (CXCL1)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     105596235 (CXCL1)   09171 Infectious disease: bacterial    05134 Legionellosis     105596235 (CXCL1)   09174 Infectious disease: parasitic    05146 Amoebiasis     105596235 (CXCL1)   09163 Immune disease    05323 Rheumatoid arthritis     105596235 (CXCL1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105596235 (CXCL1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105596235 (CXCL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105596235 (CXCL1) Cytokines and neuropeptides [BR:caty04052]  Cytokines   Chemokines    105596235 (CXCL1) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105596235 NCBI-ProteinID:  XP_011938384 Ensembl:  ENSCATG00000032400 UniProt:  A0A2K5LVJ2 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MARAALSAAPSNPRFLQVALLLLLLVATGRRAAGASVVTELRCQCLQTLQGIHPKNIQSV NVKAPGPHCAETEVIATLKNGQKACLNPATPMVKKIIEKMLNCDKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccgctctctccgcagcccctagcaatccccggttcctgcaggtggcgctg ctgctcctgctcctggtggccaccggccggcgcgcagcaggagcgtccgtggtcactgaa ttgcgctgccagtgcttgcagaccctgcaaggaattcaccccaagaatatccaaagtgtg aacgtgaaggccccaggaccccactgcgccgaaaccgaagtcatagccacactcaagaat gggcagaaagcttgtcttaaccccgcaacccccatggttaagaaaatcatcgaaaagatg ctgaactgtgacaaatccaactga

DBGET integrated database retrieval system