Cercocebus atys (sooty mangabey): 105599747 Help Entry 105599747         CDS       T07242                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04060   Cytokine-cytokine receptor interaction caty04151   PI3K-Akt signaling pathway caty04630   JAK-STAT signaling pathway caty04640   Hematopoietic cell lineage caty04657   IL-17 signaling pathway caty04658   Th1 and Th2 cell differentiation caty04659   Th17 cell differentiation caty04660   T cell receptor signaling pathway caty04664   Fc epsilon RI signaling pathway caty04672   Intestinal immune network for IgA production caty05140   Leishmaniasis caty05200   Pathways in cancer caty05310   Asthma caty05320   Autoimmune thyroid disease caty05321   Inflammatory bowel disease caty05330   Allograft rejection Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105599747 (IL4)    04151 PI3K-Akt signaling pathway     105599747 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105599747 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105599747 (IL4)    04660 T cell receptor signaling pathway     105599747 (IL4)    04658 Th1 and Th2 cell differentiation     105599747 (IL4)    04659 Th17 cell differentiation     105599747 (IL4)    04657 IL-17 signaling pathway     105599747 (IL4)    04664 Fc epsilon RI signaling pathway     105599747 (IL4)    04672 Intestinal immune network for IgA production     105599747 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105599747 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105599747 (IL4)   09163 Immune disease    05310 Asthma     105599747 (IL4)    05320 Autoimmune thyroid disease     105599747 (IL4)    05321 Inflammatory bowel disease     105599747 (IL4)    05330 Allograft rejection     105599747 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105599747 (IL4)    00536 Glycosaminoglycan binding proteins [BR:caty00536]     105599747 (IL4) Cytokines and neuropeptides [BR:caty04052]  Cytokines   Interleukins    105599747 (IL4) Glycosaminoglycan binding proteins [BR:caty00536]  Heparan sulfate / Heparin   Cytokines    105599747 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Mannosyl_trans3 DUF1907 Motif Other DBs NCBI-GeneID:  105599747 NCBI-ProteinID:  XP_011945602 Ensembl:  ENSCATG00000042947 UniProt:  A0A2K5NTL6 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MGLTSQLLPPLFFLLACAGNFAHGHNCHIALREIIETLNSLTEQKTLCTKLTITDILAAS KNTTEKETFCRAATVLRQFYSHHEKDTRCLGASAQQFHRHKQLIRFLKRLDRNLWGLAGL NSCPVKEASQSTLEDFLERLKTIMKEKYSKCRS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac tttgcccatggacacaactgccatatcgccttacgggagatcatcgaaactctgaacagc ctcacagagcagaagactctgtgcaccaagttgaccataacggacatccttgctgcctcc aagaacacaactgagaaggaaaccttctgcagggctgcaactgtgctccggcagttctac agccaccatgagaaggacactcgctgcctgggtgcgagtgcacagcagttccacaggcac aagcagctgatccgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg aactcctgtcctgtgaaggaagccagccagagtacgttggaagacttcttggaaaggcta aagacgatcatgaaagagaaatattcaaagtgtcggagctga

DBGET integrated database retrieval system