Cercocebus atys (sooty mangabey): 105600509 Help Entry 105600509         CDS       T07242                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism caty  Cercocebus atys (sooty mangabey) Pathway caty03050   Proteasome caty04060   Cytokine-cytokine receptor interaction caty04066   HIF-1 signaling pathway caty04217   Necroptosis caty04350   TGF-beta signaling pathway caty04380   Osteoclast differentiation caty04612   Antigen processing and presentation caty04630   JAK-STAT signaling pathway caty04650   Natural killer cell mediated cytotoxicity caty04657   IL-17 signaling pathway caty04658   Th1 and Th2 cell differentiation caty04659   Th17 cell differentiation caty04660   T cell receptor signaling pathway caty04940   Type I diabetes mellitus caty05140   Leishmaniasis caty05142   Chagas disease caty05143   African trypanosomiasis caty05144   Malaria caty05145   Toxoplasmosis caty05146   Amoebiasis caty05152   Tuberculosis caty05160   Hepatitis C caty05164   Influenza A caty05168   Herpes simplex virus 1 infection caty05200   Pathways in cancer caty05235   PD-L1 expression and PD-1 checkpoint pathway in cancer caty05321   Inflammatory bowel disease caty05322   Systemic lupus erythematosus caty05323   Rheumatoid arthritis caty05330   Allograft rejection caty05332   Graft-versus-host disease caty05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     105600509 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     105600509 (IFNG)    04630 JAK-STAT signaling pathway     105600509 (IFNG)    04066 HIF-1 signaling pathway     105600509 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105600509 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105600509 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     105600509 (IFNG)    04612 Antigen processing and presentation     105600509 (IFNG)    04660 T cell receptor signaling pathway     105600509 (IFNG)    04658 Th1 and Th2 cell differentiation     105600509 (IFNG)    04659 Th17 cell differentiation     105600509 (IFNG)    04657 IL-17 signaling pathway     105600509 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     105600509 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105600509 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105600509 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     105600509 (IFNG)    05164 Influenza A     105600509 (IFNG)    05168 Herpes simplex virus 1 infection     105600509 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     105600509 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     105600509 (IFNG)    05144 Malaria     105600509 (IFNG)    05145 Toxoplasmosis     105600509 (IFNG)    05140 Leishmaniasis     105600509 (IFNG)    05142 Chagas disease     105600509 (IFNG)    05143 African trypanosomiasis     105600509 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     105600509 (IFNG)    05323 Rheumatoid arthritis     105600509 (IFNG)    05321 Inflammatory bowel disease     105600509 (IFNG)    05330 Allograft rejection     105600509 (IFNG)    05332 Graft-versus-host disease     105600509 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105600509 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105600509 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:caty03051]     105600509 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105600509 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:caty00536]     105600509 (IFNG) Proteasome [BR:caty03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     105600509 (IFNG) Cytokines and neuropeptides [BR:caty04052]  Cytokines   Interferons    105600509 (IFNG) Glycosaminoglycan binding proteins [BR:caty00536]  Heparan sulfate / Heparin   Cytokines    105600509 (IFNG) SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma CCDC91 NolX Tup_N Motif Other DBs NCBI-GeneID:  105600509 NCBI-ProteinID:  XP_011947219 Ensembl:  ENSCATG00000034911 UniProt:  P42162 LinkDB All DBs Position Unknown AA seq 165 aa AA seqDB search MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWK EESDRKIMQSQIVSFYFKLFKSFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAVHELIQVMAELSPAAKIGKRKRSQTFRGRRASQ NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgaaatatacaagttatatcttggcttttcagctctgcattgttttgggttctcttggg tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca ggtgatccagatgtagcagataatggaactcttttcttagacatcttgaggaattggaaa gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt aaaagcttcaaagatgaccagaggatccaaaagagtgtggagaccatcaaggaagacatt aatgtcaagtttttcaatagcaacaaaaagaaacgggatgacttcgaaaagctgaccaat tattcggtaactgacttgaatgtccaacgcaaagcagtacatgaactcatccaagtgatg gctgaactgtcgccagcagctaaaatagggaagcgaaaaaggagtcagacgtttcgaggt cgaagagcatcccaataa

DBGET integrated database retrieval system