Carassius auratus (goldfish): 113042903 Help Entry 113042903         CDS       T07313                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism caua  Carassius auratus (goldfish) Pathway caua00510   N-Glycan biosynthesis caua00513   Various types of N-glycan biosynthesis caua04141   Protein processing in endoplasmic reticulum Module caua_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:caua00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     113042903    00513 Various types of N-glycan biosynthesis     113042903  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113042903 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  113042903 NCBI-ProteinID:  XP_026057694 UniProt:  A0A6P6JB73 LinkDB All DBs Position 25:720144..722245 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSLVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDLYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagttggaagccatgacaagatacaccagtctggtgaacccggccgtgtttcctcac ctcactgtagtgctgctggccatcggcatgttcttcaccgcctggttctttgtatatgaa gtaacgtccacgaagtacacgcgagatctgtacaaagagctgctcatttctctggtggcg tcgctcttcatgggcttcggcgttctgttcctcttactgtgggtcggcatttatgtctga

DBGET integrated database retrieval system