Carassius auratus (goldfish): 113047604 Help Entry 113047604         CDS       T07313                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism caua  Carassius auratus (goldfish) Pathway caua03420   Nucleotide excision repair caua04110   Cell cycle caua04114   Oocyte meiosis caua04120   Ubiquitin mediated proteolysis caua04141   Protein processing in endoplasmic reticulum caua04310   Wnt signaling pathway caua04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:caua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113047604    04120 Ubiquitin mediated proteolysis     113047604   09124 Replication and repair    03420 Nucleotide excision repair     113047604  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     113047604    04350 TGF-beta signaling pathway     113047604  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     113047604    04114 Oocyte meiosis     113047604  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:caua04121]     113047604    03400 DNA repair and recombination proteins [BR:caua03400]     113047604 Enzymes [BR:caua01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      113047604 Ubiquitin system [BR:caua04121]  Ubiquitin ligases (E3)   UBL E3 ligases    113047604   Multi subunit type E3    SCF complex     Ring finger protein      113047604    Cul2 complex      113047604    Cul3 complex      113047604    Cul4 complex      113047604    Cul7 complex      113047604    Cul8 complex      113047604    Cul9 complex      113047604 DNA repair and recombination proteins [BR:caua03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       113047604     TCR (transcription coupled repair) factors      Cul4-CSA complex       113047604 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  113047604 NCBI-ProteinID:  XP_026064756 Ensembl:  ENSCARG00000064356 UniProt:  A0A6P6JXU1 LinkDB All DBs Position 3:complement(10650145..10651946) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPGGANSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcaatggacgtagacacccctggtggagctaacagtggagccagtaaaaag cgttttgaagtgaaaaagtggaacgctgtggctctgtgggcttgggacattgtggtggac aactgtgccatttgtagaaatcacattatggacctctgtatagagtgtcaggctaatcag gcgtcagctacatcagaggagtgcacagtggcctggggagtctgtaatcatgcgtttcat ttccactgcatctctcgctggctgaagaccaggcaggtgtgtcctctggacaacagagag tgggagttccagaagtacggccattag

DBGET integrated database retrieval system