Carassius auratus (goldfish): 113080821 Help Entry 113080821         CDS       T07313                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism caua  Carassius auratus (goldfish) Pathway caua00510   N-Glycan biosynthesis caua00513   Various types of N-glycan biosynthesis caua04141   Protein processing in endoplasmic reticulum Module caua_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:caua00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     113080821    00513 Various types of N-glycan biosynthesis     113080821  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113080821 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  113080821 NCBI-ProteinID:  XP_026108658 Ensembl:  ENSCARG00000048455 UniProt:  A0A6P6NJC0 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLMAIGMFFTAWFFVYEVTSTKYTRDLYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaagccatgactagatacaccagtccagtgaaccctgcagtgtttcctcac ctcactgtagtactgatggccatcggcatgttcttcaccgcctggttctttgtatatgaa gtgacgtccacgaagtacacgcgagatctgtacaaagagctgctgatttctctggtggct tcgctcttcatgggcttcggcgttctgttcctcttactgtgggtcggcatttatgtctga

DBGET integrated database retrieval system