Corylus avellana (European hazelnut): 132166306 Help Entry 132166306         CDS       T09426                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cave  Corylus avellana (European hazelnut) Pathway cave03420   Nucleotide excision repair cave04120   Ubiquitin mediated proteolysis cave04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cave00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132166306    04120 Ubiquitin mediated proteolysis     132166306   09124 Replication and repair    03420 Nucleotide excision repair     132166306  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cave04121]     132166306    03400 DNA repair and recombination proteins [BR:cave03400]     132166306 Enzymes [BR:cave01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      132166306 Ubiquitin system [BR:cave04121]  Ubiquitin ligases (E3)   UBL E3 ligases    132166306   Multi subunit type E3    SCF complex     Ring finger protein      132166306    Cul2 complex      132166306    Cul3 complex      132166306    Cul4 complex      132166306    Cul7 complex      132166306    Cul8 complex      132166306    Cul9 complex      132166306 DNA repair and recombination proteins [BR:cave03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       132166306     TCR (transcription coupled repair) factors      Cul4-CSA complex       132166306 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  132166306 NCBI-ProteinID:  XP_059433086 UniProt:  A0ACM5JVL9 LinkDB All DBs Position ca11 Genome browser AA seq 119 aa AA seqDB search MATLDSDVPMVPVGEPSSSAGPSSSSNKKNKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggccaccttggactccgacgtgcccatggtcccagtcggcgagccttcgagcagcgcg ggtccttcctcctcctccaacaagaagaacaagcgcttcgagatcaagaagtggaacgcc gtcgccctctgggcctgggatattgtggttgataactgtgcgatttgccggaaccatatt atggatctctgcattgagtgccaagcgaaccaggccagcgccacgagcgaggaatgtaca gttgcttggggggtttgcaaccatgcctttcattttcactgcatcagccgatggctcaaa acccgtcaagtgtgcccactagataacagcgagtgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system