Ciconia boyciana (Oriental stork): 140654741 Help Entry 140654741         CDS       T10948                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy03420   Nucleotide excision repair cboy04110   Cell cycle cboy04114   Oocyte meiosis cboy04120   Ubiquitin mediated proteolysis cboy04141   Protein processing in endoplasmic reticulum cboy04310   Wnt signaling pathway cboy04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:cboy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     140654741 (RBX1)    04120 Ubiquitin mediated proteolysis     140654741 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     140654741 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     140654741 (RBX1)    04350 TGF-beta signaling pathway     140654741 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     140654741 (RBX1)    04114 Oocyte meiosis     140654741 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cboy04121]     140654741 (RBX1)    03400 DNA repair and recombination proteins [BR:cboy03400]     140654741 (RBX1) Enzymes [BR:cboy01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      140654741 (RBX1) Ubiquitin system [BR:cboy04121]  Ubiquitin ligases (E3)   UBL E3 ligases    140654741 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      140654741 (RBX1)    Cul2 complex      140654741 (RBX1)    Cul3 complex      140654741 (RBX1)    Cul4 complex      140654741 (RBX1)    Cul7 complex      140654741 (RBX1)    Cul8 complex      140654741 (RBX1)    Cul9 complex      140654741 (RBX1) DNA repair and recombination proteins [BR:cboy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       140654741 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       140654741 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  140654741 NCBI-ProteinID:  XP_072724534 LinkDB All DBs Position 1:complement(56859530..56871493) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtggacacccctagcggcaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgcagtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccatattatggatctatgcatagaatgtcaagcaaaccaa gcatcagctacctctgaagagtgcacagttgcatggggtgtctgcaatcatgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgtccgctggacaacagagaa tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system