Coxiella burnetii RSA 493: CBU_1993 Help Entry CBU_1993          CDS       T00124                                  Symbol folA Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism cbu  Coxiella burnetii RSA 493 Pathway cbu00670   One carbon pool by folate cbu00790   Folate biosynthesis cbu01100   Metabolic pathways cbu01240   Biosynthesis of cofactors cbu04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:cbu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CBU_1993 (folA)    00670 One carbon pool by folate     CBU_1993 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CBU_1993 (folA) Enzymes [BR:cbu01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CBU_1993 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 COG2_C Methyltransf_2 Motif Other DBs NCBI-GeneID:  1209906 NCBI-ProteinID:  NP_820968 UniProt:  Q83AB2 Structure PDBPDBj LinkDB All DBs Position complement(1900775..1901260) Genome browser AA seq 161 aa AA seqDB search MIITLIAAMDKNRLIGRNNELPWHLPADLAHFKSITLGKPIVMGRRTFDSIGKPLPHRRN IVITQQKNLIIEGCDIFYSLDDALSALTKEPEVIIIGGARIFKEALPKADKMILTIINHS FEGDVYFPEWNDKEWKITSQIKHERDEKNPYPFQFLELRRL NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgattattactctaattgccgcgatggataaaaatcgactgattggccgaaataacgag ctgccgtggcatttgcctgctgatttagcccattttaaatcgattacgctcggcaagccg attgtgatgggccgacggacgtttgacagcattgggaaacctttgcctcaccgccgaaat attgtcattacgcagcaaaaaaatttaattattgaaggttgtgatattttctattctttg gatgacgcactgagcgcattgaccaaggagcccgaagtaataatcatcggcggcgctcgc attttcaaagaggcgttgccgaaggccgataaaatgatcttgactatcatcaatcactct tttgaaggtgatgtttattttcctgaatggaatgataaagaatggaaaattacctcacaa attaaacacgaacgggacgaaaaaaatccttatccttttcagtttttagaattaaggcga ttatag

DBGET integrated database retrieval system