Cervus canadensis (wapiti): 122427438 Help Entry 122427438         CDS       T07554                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism ccad  Cervus canadensis (wapiti) Pathway ccad03050   Proteasome ccad04060   Cytokine-cytokine receptor interaction ccad04066   HIF-1 signaling pathway ccad04217   Necroptosis ccad04350   TGF-beta signaling pathway ccad04380   Osteoclast differentiation ccad04612   Antigen processing and presentation ccad04630   JAK-STAT signaling pathway ccad04650   Natural killer cell mediated cytotoxicity ccad04657   IL-17 signaling pathway ccad04658   Th1 and Th2 cell differentiation ccad04659   Th17 cell differentiation ccad04660   T cell receptor signaling pathway ccad04940   Type I diabetes mellitus ccad05140   Leishmaniasis ccad05142   Chagas disease ccad05143   African trypanosomiasis ccad05144   Malaria ccad05145   Toxoplasmosis ccad05146   Amoebiasis ccad05152   Tuberculosis ccad05160   Hepatitis C ccad05164   Influenza A ccad05168   Herpes simplex virus 1 infection ccad05200   Pathways in cancer ccad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccad05321   Inflammatory bowel disease ccad05322   Systemic lupus erythematosus ccad05323   Rheumatoid arthritis ccad05330   Allograft rejection ccad05332   Graft-versus-host disease ccad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     122427438 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     122427438 (IFNG)    04630 JAK-STAT signaling pathway     122427438 (IFNG)    04066 HIF-1 signaling pathway     122427438 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122427438 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122427438 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     122427438 (IFNG)    04612 Antigen processing and presentation     122427438 (IFNG)    04660 T cell receptor signaling pathway     122427438 (IFNG)    04658 Th1 and Th2 cell differentiation     122427438 (IFNG)    04659 Th17 cell differentiation     122427438 (IFNG)    04657 IL-17 signaling pathway     122427438 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     122427438 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122427438 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122427438 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     122427438 (IFNG)    05164 Influenza A     122427438 (IFNG)    05168 Herpes simplex virus 1 infection     122427438 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     122427438 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     122427438 (IFNG)    05144 Malaria     122427438 (IFNG)    05145 Toxoplasmosis     122427438 (IFNG)    05140 Leishmaniasis     122427438 (IFNG)    05142 Chagas disease     122427438 (IFNG)    05143 African trypanosomiasis     122427438 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     122427438 (IFNG)    05323 Rheumatoid arthritis     122427438 (IFNG)    05321 Inflammatory bowel disease     122427438 (IFNG)    05330 Allograft rejection     122427438 (IFNG)    05332 Graft-versus-host disease     122427438 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     122427438 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     122427438 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:ccad03051]     122427438 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122427438 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:ccad00536]     122427438 (IFNG) Proteasome [BR:ccad03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     122427438 (IFNG) Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Interferons    122427438 (IFNG) Glycosaminoglycan binding proteins [BR:ccad00536]  Heparan sulfate / Heparin   Cytokines    122427438 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma API5 PRANC PAZ_2 Motif Other DBs NCBI-GeneID:  122427438 NCBI-ProteinID:  XP_043302847 LinkDB All DBs Position 25:complement(11691572..11696411) Genome browser AA seq 166 aa AA seqDB search MKYTSYILALQLCVLLGFSGSYGQGPFFKEIENLKEYFNASNPDVAEGGPLFIEILKNWK EESDRKIIQSQIVSFYFKLFENFKDNQVIQRSVDIIKQDMFQKFLNGSSEKLEDFKKLIQ ISVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatatacaagctatatcttagctttacagctctgcgtgcttttgggtttttctggt tcttatggccagggcccattttttaaagaaatagaaaacttaaaggagtattttaatgca agtaacccagatgtagctgagggtgggcctcttttcatagaaattttgaagaattggaaa gaggagagtgacagaaaaattattcagagccaaattgtctccttctacttcaaactcttt gaaaacttcaaagataaccaggtcattcagaggagcgtggatatcatcaagcaagacatg tttcagaagttcttgaatggcagctctgagaaactggaggacttcaaaaagctgattcaa atttcggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaagtgatg aatgacctgtcgccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga ggccggagagcatcaatgtaa

DBGET integrated database retrieval system