Cervus canadensis (wapiti): 122439281 Help Entry 122439281         CDS       T07554                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism ccad  Cervus canadensis (wapiti) Pathway ccad04060   Cytokine-cytokine receptor interaction ccad04151   PI3K-Akt signaling pathway ccad04630   JAK-STAT signaling pathway ccad04640   Hematopoietic cell lineage ccad04657   IL-17 signaling pathway ccad04658   Th1 and Th2 cell differentiation ccad04659   Th17 cell differentiation ccad04660   T cell receptor signaling pathway ccad04664   Fc epsilon RI signaling pathway ccad04672   Intestinal immune network for IgA production ccad05140   Leishmaniasis ccad05200   Pathways in cancer ccad05310   Asthma ccad05320   Autoimmune thyroid disease ccad05321   Inflammatory bowel disease ccad05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122439281 (IL4)    04151 PI3K-Akt signaling pathway     122439281 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122439281 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     122439281 (IL4)    04660 T cell receptor signaling pathway     122439281 (IL4)    04658 Th1 and Th2 cell differentiation     122439281 (IL4)    04659 Th17 cell differentiation     122439281 (IL4)    04657 IL-17 signaling pathway     122439281 (IL4)    04664 Fc epsilon RI signaling pathway     122439281 (IL4)    04672 Intestinal immune network for IgA production     122439281 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122439281 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     122439281 (IL4)   09163 Immune disease    05310 Asthma     122439281 (IL4)    05320 Autoimmune thyroid disease     122439281 (IL4)    05321 Inflammatory bowel disease     122439281 (IL4)    05330 Allograft rejection     122439281 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122439281 (IL4)    00536 Glycosaminoglycan binding proteins [BR:ccad00536]     122439281 (IL4) Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Interleukins    122439281 (IL4) Glycosaminoglycan binding proteins [BR:ccad00536]  Heparan sulfate / Heparin   Cytokines    122439281 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 DUF4942 Motif Other DBs NCBI-GeneID:  122439281 NCBI-ProteinID:  XP_043320301 LinkDB All DBs Position 4:85534430..85542265 Genome browser AA seq 135 aa AA seqDB search MGLTSQLIPVLVCLLACTSHFVHGHKCDITLEEIIKTLNILTARKNSCMELPVADVFAAP KNTTEKETFCRAGIELRRIYRSHTCLNRFLSRLDRNLSGLASKTCSVNEAKTSTSTLKNL LERLKTIMKEKYSKC NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggggctcacctcccagctgatcccagtgctggtctgcttactggcatgtaccagccac ttcgtccacggacacaagtgcgatattaccttagaagagatcatcaaaacgctgaacatc ctcacagcgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca aagaacacaactgagaaggaaaccttctgcagggctggaattgagcttaggcgtatctac aggagccacacgtgcttgaacagattcctgagcagacttgacaggaatctcagcggcttg gcaagcaagacctgttctgtgaatgaagccaagacgagtacaagtacgctgaaaaacctc ttggaaaggctaaagacaattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system