KEGG   Cervus canadensis (wapiti): 122440231
Entry
122440231         CDS       T07554                                 
Name
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2-like
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
ccad  Cervus canadensis (wapiti)
Pathway
ccad01521  EGFR tyrosine kinase inhibitor resistance
ccad01522  Endocrine resistance
ccad04010  MAPK signaling pathway
ccad04012  ErbB signaling pathway
ccad04014  Ras signaling pathway
ccad04015  Rap1 signaling pathway
ccad04022  cGMP-PKG signaling pathway
ccad04024  cAMP signaling pathway
ccad04066  HIF-1 signaling pathway
ccad04068  FoxO signaling pathway
ccad04071  Sphingolipid signaling pathway
ccad04072  Phospholipase D signaling pathway
ccad04140  Autophagy - animal
ccad04148  Efferocytosis
ccad04150  mTOR signaling pathway
ccad04151  PI3K-Akt signaling pathway
ccad04210  Apoptosis
ccad04218  Cellular senescence
ccad04270  Vascular smooth muscle contraction
ccad04370  VEGF signaling pathway
ccad04371  Apelin signaling pathway
ccad04517  IgSF CAM signaling
ccad04540  Gap junction
ccad04550  Signaling pathways regulating pluripotency of stem cells
ccad04613  Neutrophil extracellular trap formation
ccad04620  Toll-like receptor signaling pathway
ccad04650  Natural killer cell mediated cytotoxicity
ccad04660  T cell receptor signaling pathway
ccad04662  B cell receptor signaling pathway
ccad04664  Fc epsilon RI signaling pathway
ccad04720  Long-term potentiation
ccad04722  Neurotrophin signaling pathway
ccad04730  Long-term depression
ccad04810  Regulation of actin cytoskeleton
ccad04910  Insulin signaling pathway
ccad04912  GnRH signaling pathway
ccad04915  Estrogen signaling pathway
ccad04916  Melanogenesis
ccad04917  Prolactin signaling pathway
ccad04919  Thyroid hormone signaling pathway
ccad04921  Oxytocin signaling pathway
ccad04926  Relaxin signaling pathway
ccad04929  GnRH secretion
ccad04934  Cushing syndrome
ccad04935  Growth hormone synthesis, secretion and action
ccad05010  Alzheimer disease
ccad05022  Pathways of neurodegeneration - multiple diseases
ccad05132  Salmonella infection
ccad05135  Yersinia infection
ccad05160  Hepatitis C
ccad05161  Hepatitis B
ccad05163  Human cytomegalovirus infection
ccad05164  Influenza A
ccad05165  Human papillomavirus infection
ccad05166  Human T-cell leukemia virus 1 infection
ccad05167  Kaposi sarcoma-associated herpesvirus infection
ccad05170  Human immunodeficiency virus 1 infection
ccad05200  Pathways in cancer
ccad05205  Proteoglycans in cancer
ccad05206  MicroRNAs in cancer
ccad05207  Chemical carcinogenesis - receptor activation
ccad05208  Chemical carcinogenesis - reactive oxygen species
ccad05210  Colorectal cancer
ccad05211  Renal cell carcinoma
ccad05213  Endometrial cancer
ccad05214  Glioma
ccad05215  Prostate cancer
ccad05216  Thyroid cancer
ccad05218  Melanoma
ccad05219  Bladder cancer
ccad05220  Chronic myeloid leukemia
ccad05221  Acute myeloid leukemia
ccad05223  Non-small cell lung cancer
ccad05224  Breast cancer
ccad05225  Hepatocellular carcinoma
ccad05226  Gastric cancer
ccad05230  Central carbon metabolism in cancer
ccad05231  Choline metabolism in cancer
ccad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ccad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    122440231
   04012 ErbB signaling pathway
    122440231
   04014 Ras signaling pathway
    122440231
   04015 Rap1 signaling pathway
    122440231
   04370 VEGF signaling pathway
    122440231
   04371 Apelin signaling pathway
    122440231
   04066 HIF-1 signaling pathway
    122440231
   04068 FoxO signaling pathway
    122440231
   04072 Phospholipase D signaling pathway
    122440231
   04071 Sphingolipid signaling pathway
    122440231
   04024 cAMP signaling pathway
    122440231
   04022 cGMP-PKG signaling pathway
    122440231
   04151 PI3K-Akt signaling pathway
    122440231
   04150 mTOR signaling pathway
    122440231
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    122440231
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    122440231
   04148 Efferocytosis
    122440231
  09143 Cell growth and death
   04210 Apoptosis
    122440231
   04218 Cellular senescence
    122440231
  09144 Cellular community - eukaryotes
   04540 Gap junction
    122440231
   04550 Signaling pathways regulating pluripotency of stem cells
    122440231
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122440231
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    122440231
   04620 Toll-like receptor signaling pathway
    122440231
   04650 Natural killer cell mediated cytotoxicity
    122440231
   04660 T cell receptor signaling pathway
    122440231
   04662 B cell receptor signaling pathway
    122440231
   04664 Fc epsilon RI signaling pathway
    122440231
  09152 Endocrine system
   04910 Insulin signaling pathway
    122440231
   04929 GnRH secretion
    122440231
   04912 GnRH signaling pathway
    122440231
   04915 Estrogen signaling pathway
    122440231
   04917 Prolactin signaling pathway
    122440231
   04921 Oxytocin signaling pathway
    122440231
   04926 Relaxin signaling pathway
    122440231
   04935 Growth hormone synthesis, secretion and action
    122440231
   04919 Thyroid hormone signaling pathway
    122440231
   04916 Melanogenesis
    122440231
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    122440231
  09156 Nervous system
   04720 Long-term potentiation
    122440231
   04730 Long-term depression
    122440231
   04722 Neurotrophin signaling pathway
    122440231
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122440231
   05206 MicroRNAs in cancer
    122440231
   05205 Proteoglycans in cancer
    122440231
   05207 Chemical carcinogenesis - receptor activation
    122440231
   05208 Chemical carcinogenesis - reactive oxygen species
    122440231
   05230 Central carbon metabolism in cancer
    122440231
   05231 Choline metabolism in cancer
    122440231
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    122440231
  09162 Cancer: specific types
   05210 Colorectal cancer
    122440231
   05225 Hepatocellular carcinoma
    122440231
   05226 Gastric cancer
    122440231
   05214 Glioma
    122440231
   05216 Thyroid cancer
    122440231
   05221 Acute myeloid leukemia
    122440231
   05220 Chronic myeloid leukemia
    122440231
   05218 Melanoma
    122440231
   05211 Renal cell carcinoma
    122440231
   05219 Bladder cancer
    122440231
   05215 Prostate cancer
    122440231
   05213 Endometrial cancer
    122440231
   05224 Breast cancer
    122440231
   05223 Non-small cell lung cancer
    122440231
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    122440231
   05170 Human immunodeficiency virus 1 infection
    122440231
   05161 Hepatitis B
    122440231
   05160 Hepatitis C
    122440231
   05164 Influenza A
    122440231
   05163 Human cytomegalovirus infection
    122440231
   05167 Kaposi sarcoma-associated herpesvirus infection
    122440231
   05165 Human papillomavirus infection
    122440231
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    122440231
   05135 Yersinia infection
    122440231
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122440231
   05022 Pathways of neurodegeneration - multiple diseases
    122440231
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    122440231
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    122440231
   01522 Endocrine resistance
    122440231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccad01001]
    122440231
Enzymes [BR:ccad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     122440231
Protein kinases [BR:ccad01001]
 Serine/threonine kinases: STE group
  STE7 family
   122440231
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like Haspin_kinase Seadorna_VP7 APH Kdo
Other DBs
NCBI-GeneID: 122440231
NCBI-ProteinID: XP_043322146
LinkDB
Position
4:87250710..87265372
AA seq 286 aa
MARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQ
VLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSG
QLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEA
IFGRPMVDGVEGEPPSISPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGV
FTQDFQEFVNKCRHPSLLALQARHLPAPRSAFEACFRETALFPPCG
NT seq 861 nt   +upstreamnt  +downstreamnt
atggccagaaagctgatccacctggagatcaagccagccatccggaaccagatcattcga
gagctacaagtgttgcacgagtgcaactccccgtacatcgtgggcttctacggggccttc
tacagcgacggcgaaatcagcatctgcatggagcacatggatggcggctccctggaccag
gtgttgaaagaagccaagagaatccccgaagagatcctgggcaaggtcagcatcgcggtt
ctgcggggcctggcatacctccgggagaaacaccagatcatgcaccgagacgtgaagccg
tccaacatcctcgtcaactcccgaggggagatcaagctgtgtgacttcggggtgagcggc
cagctcatcgactccatggccaactccttcgtggggacgcggtcctacatgtctccggag
cggctacaaggcacccactactcggtgcagtcagacatctggagcatgggcctgtccctg
gtggaactgtccatcggaaggtaccccatccccccgccggatgccaaggagctggaggcc
atatttggccggcccatggtcgatggtgtggaaggagaacctcccagcatctcgccgcgg
ccgaggccccccggacgccccatcagcggtcacgggatggacagccggccagccatggcg
atctttgagctgctggactacatcgtgaacgagcctcctcccaagctgcccaacggtgtg
ttcacccaggacttccaggagtttgtaaataaatgcaggcaccccagtttgttggccctt
caagcccgtcacctcccagctcccaggtcagccttcgaagcctgcttcagggagacagcc
ctcttccccccctgtgggtga

DBGET integrated database retrieval system