Cervus canadensis (wapiti): 122443873 Help Entry 122443873         CDS       T07554                                  Symbol FOS Name (RefSeq) proto-oncogene C-Fos   KO K04379   proto-oncogene protein c-fos Organism ccad  Cervus canadensis (wapiti) Pathway ccad01522   Endocrine resistance ccad04010   MAPK signaling pathway ccad04024   cAMP signaling pathway ccad04210   Apoptosis ccad04380   Osteoclast differentiation ccad04620   Toll-like receptor signaling pathway ccad04657   IL-17 signaling pathway ccad04658   Th1 and Th2 cell differentiation ccad04659   Th17 cell differentiation ccad04660   T cell receptor signaling pathway ccad04662   B cell receptor signaling pathway ccad04668   TNF signaling pathway ccad04713   Circadian entrainment ccad04725   Cholinergic synapse ccad04728   Dopaminergic synapse ccad04915   Estrogen signaling pathway ccad04917   Prolactin signaling pathway ccad04921   Oxytocin signaling pathway ccad04926   Relaxin signaling pathway ccad04928   Parathyroid hormone synthesis, secretion and action ccad04932   Non-alcoholic fatty liver disease ccad04935   Growth hormone synthesis, secretion and action ccad05031   Amphetamine addiction ccad05132   Salmonella infection ccad05133   Pertussis ccad05135   Yersinia infection ccad05140   Leishmaniasis ccad05142   Chagas disease ccad05161   Hepatitis B ccad05162   Measles ccad05166   Human T-cell leukemia virus 1 infection ccad05167   Kaposi sarcoma-associated herpesvirus infection ccad05170   Human immunodeficiency virus 1 infection ccad05171   Coronavirus disease - COVID-19 ccad05200   Pathways in cancer ccad05207   Chemical carcinogenesis - receptor activation ccad05208   Chemical carcinogenesis - reactive oxygen species ccad05210   Colorectal cancer ccad05224   Breast cancer ccad05231   Choline metabolism in cancer ccad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccad05323   Rheumatoid arthritis ccad05417   Lipid and atherosclerosis ccad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122443873 (FOS)    04668 TNF signaling pathway     122443873 (FOS)    04024 cAMP signaling pathway     122443873 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     122443873 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122443873 (FOS)    04660 T cell receptor signaling pathway     122443873 (FOS)    04658 Th1 and Th2 cell differentiation     122443873 (FOS)    04659 Th17 cell differentiation     122443873 (FOS)    04657 IL-17 signaling pathway     122443873 (FOS)    04662 B cell receptor signaling pathway     122443873 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     122443873 (FOS)    04917 Prolactin signaling pathway     122443873 (FOS)    04921 Oxytocin signaling pathway     122443873 (FOS)    04926 Relaxin signaling pathway     122443873 (FOS)    04935 Growth hormone synthesis, secretion and action     122443873 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     122443873 (FOS)   09156 Nervous system    04725 Cholinergic synapse     122443873 (FOS)    04728 Dopaminergic synapse     122443873 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     122443873 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     122443873 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122443873 (FOS)    05207 Chemical carcinogenesis - receptor activation     122443873 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     122443873 (FOS)    05231 Choline metabolism in cancer     122443873 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122443873 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     122443873 (FOS)    05224 Breast cancer     122443873 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122443873 (FOS)    05170 Human immunodeficiency virus 1 infection     122443873 (FOS)    05161 Hepatitis B     122443873 (FOS)    05171 Coronavirus disease - COVID-19     122443873 (FOS)    05162 Measles     122443873 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     122443873 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     122443873 (FOS)    05135 Yersinia infection     122443873 (FOS)    05133 Pertussis     122443873 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     122443873 (FOS)    05142 Chagas disease     122443873 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     122443873 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     122443873 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122443873 (FOS)    05418 Fluid shear stress and atherosclerosis     122443873 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     122443873 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     122443873 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ccad03000]     122443873 (FOS)    04131 Membrane trafficking [BR:ccad04131]     122443873 (FOS) Transcription factors [BR:ccad03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     122443873 (FOS) Membrane trafficking [BR:ccad04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     122443873 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 HALZ Motif Other DBs NCBI-GeneID:  122443873 NCBI-ProteinID:  XP_043328522 LinkDB All DBs Position 6:81114872..81118337 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRA QSIGRRGKMEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPPVEPVKSVGSMELKAEPFDDFMFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcttcctcccgctgcagcagcgcc tccccggccggggacagtctctcctactaccactcaccggccgactccttctccagcatg ggctctcccgtcaatgcgcaggactactgcaccgatctggctgtctccagtgccaacttc atcccaacagtgactgccatctcgaccagcccggacctacaatggctagtgcagcccacc ctggtctcctccgtggccccgtcccagaccagagccccccacccctatggagttcccact ccctcagctggggcttactccagggctggagtcatgaaaaccatgacgggaggcagagct cagagcattggccggaggggcaagatggaacagttgtccccagaagaggaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggcggagggag ctgactgacaccctccaagcggagacagaccaactagaagatgagaagtctgctttgcag acggagattgccaatctgctgaaggagaaggaaaaactcgagttcatcctagcggctcac cgacctgcgtgcaagatccccgacgacctgggctttccagaagagatgtctgtggcttcc cttgatctgagtgggggcctgcctgaggctgccacccctgaatctgaggaggccttcacc ctgcccctcctcaatgaccccgagcccaagcccccagtggagcccgtcaagagcgtcggc agcatggagctgaaggctgagccctttgatgacttcatgttcccagcatcgtccaggccc agcggctcggagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacggtggctccctggggatggggcctatggccacggagctg gagcctctgtgcaccccggtggtcacctgtactcccagctgcactacttacacgtcttcc ttcgtcttcacctaccctgaggctgactccttccccagctgtgcagctgcccaccgcaag ggcagcagcagcaacgagccttcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system