Cervus canadensis (wapiti): 122449871 Help Entry 122449871         CDS       T07554                                  Name (RefSeq) protein max   KO K04453   Max protein Organism ccad  Cervus canadensis (wapiti) Pathway ccad03083   Polycomb repressive complex ccad04010   MAPK signaling pathway ccad05200   Pathways in cancer ccad05202   Transcriptional misregulation in cancer ccad05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:ccad00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     122449871  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122449871  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122449871    05202 Transcriptional misregulation in cancer     122449871   09162 Cancer: specific types    05222 Small cell lung cancer     122449871  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ccad03000]     122449871    03036 Chromosome and associated proteins [BR:ccad03036]     122449871 Transcription factors [BR:ccad03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     122449871 Chromosome and associated proteins [BR:ccad03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      122449871 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH bZIP_2 JetA Filament TPR bHLH_SAC51 bHLH_INO4 SlyX PUMA_CC ANG-1 SLX9 GAGA_bind DUF7801 DUF4763 Csm1_N Motif Other DBs NCBI-GeneID:  122449871 NCBI-ProteinID:  XP_043337862 LinkDB All DBs Position 11:55754356..55755997 Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDS SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacggaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgatgacctcaagcggcagaatgctctcctggagcagcaagtccgt gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacagc agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc agctcggagtcagagcccgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system