Cervus canadensis (wapiti): 122453183 Help Entry 122453183         CDS       T07554                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism ccad  Cervus canadensis (wapiti) Pathway ccad01521   EGFR tyrosine kinase inhibitor resistance ccad04010   MAPK signaling pathway ccad04014   Ras signaling pathway ccad04015   Rap1 signaling pathway ccad04020   Calcium signaling pathway ccad04151   PI3K-Akt signaling pathway ccad04550   Signaling pathways regulating pluripotency of stem cells ccad04810   Regulation of actin cytoskeleton ccad05167   Kaposi sarcoma-associated herpesvirus infection ccad05200   Pathways in cancer ccad05205   Proteoglycans in cancer ccad05207   Chemical carcinogenesis - receptor activation ccad05218   Melanoma ccad05224   Breast cancer ccad05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122453183 (FGF2)    04014 Ras signaling pathway     122453183 (FGF2)    04015 Rap1 signaling pathway     122453183 (FGF2)    04020 Calcium signaling pathway     122453183 (FGF2)    04151 PI3K-Akt signaling pathway     122453183 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     122453183 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122453183 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122453183 (FGF2)    05205 Proteoglycans in cancer     122453183 (FGF2)    05207 Chemical carcinogenesis - receptor activation     122453183 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     122453183 (FGF2)    05218 Melanoma     122453183 (FGF2)    05224 Breast cancer     122453183 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     122453183 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     122453183 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122453183 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:ccad00536]     122453183 (FGF2) Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Growth factors (RTK binding)    122453183 (FGF2) Glycosaminoglycan binding proteins [BR:ccad00536]  Heparan sulfate / Heparin   Growth factors/receptors    122453183 (FGF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  122453183 NCBI-ProteinID:  XP_043343006 LinkDB All DBs Position 1:complement(92301148..92353817) Genome browser AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggccgccgggagcatcaccacgctgcccgccctgccggaggacggcggcagcggcgct ttcccgccgggccacttcaaggaccccaagcggctgtactgcaagaacgggggcttcttc ctgcgcatccaccccgacggccgagtggacggggtccgcgagaagagtgaccctcacatc aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcgaac cgttatcttgctatgaaagaagatggaagattattggcttcgaaatgtgttacagacgag tgtttcttttttgaacgattggagtctaataactacaatacttaccggtcaaggaaatac tccagttggtatgtggcactgaaacgaactgggcagtataaacttggacccaaaacagga cctgggcagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system