Cervus canadensis (wapiti): 122453394 Help Entry 122453394         CDS       T07554                                  Name (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism ccad  Cervus canadensis (wapiti) Pathway ccad04060   Cytokine-cytokine receptor interaction ccad04151   PI3K-Akt signaling pathway ccad04217   Necroptosis ccad04380   Osteoclast differentiation ccad04620   Toll-like receptor signaling pathway ccad04621   NOD-like receptor signaling pathway ccad04622   RIG-I-like receptor signaling pathway ccad04623   Cytosolic DNA-sensing pathway ccad04630   JAK-STAT signaling pathway ccad04650   Natural killer cell mediated cytotoxicity ccad04668   TNF signaling pathway ccad04936   Alcoholic liver disease ccad05135   Yersinia infection ccad05142   Chagas disease ccad05152   Tuberculosis ccad05160   Hepatitis C ccad05161   Hepatitis B ccad05162   Measles ccad05163   Human cytomegalovirus infection ccad05164   Influenza A ccad05165   Human papillomavirus infection ccad05167   Kaposi sarcoma-associated herpesvirus infection ccad05168   Herpes simplex virus 1 infection ccad05169   Epstein-Barr virus infection ccad05170   Human immunodeficiency virus 1 infection ccad05171   Coronavirus disease - COVID-19 ccad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122453394    04668 TNF signaling pathway     122453394    04151 PI3K-Akt signaling pathway     122453394   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122453394  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122453394  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122453394    04621 NOD-like receptor signaling pathway     122453394    04622 RIG-I-like receptor signaling pathway     122453394    04623 Cytosolic DNA-sensing pathway     122453394    04650 Natural killer cell mediated cytotoxicity     122453394   09158 Development and regeneration    04380 Osteoclast differentiation     122453394  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122453394    05161 Hepatitis B     122453394    05160 Hepatitis C     122453394    05171 Coronavirus disease - COVID-19     122453394    05164 Influenza A     122453394    05162 Measles     122453394    05168 Herpes simplex virus 1 infection     122453394    05163 Human cytomegalovirus infection     122453394    05167 Kaposi sarcoma-associated herpesvirus infection     122453394    05169 Epstein-Barr virus infection     122453394    05165 Human papillomavirus infection     122453394   09171 Infectious disease: bacterial    05135 Yersinia infection     122453394    05152 Tuberculosis     122453394   09174 Infectious disease: parasitic    05142 Chagas disease     122453394   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122453394   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122453394  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122453394 Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Interferons    122453394 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon PrlF_antitoxin Motif Other DBs NCBI-GeneID:  122453394 NCBI-ProteinID:  XP_043343332 LinkDB All DBs Position 14:complement(47993727..47994287) Genome browser AA seq 186 aa AA seqDB search MTYRCLLQMALLLCFSTTALSMNYSLLRFQQRRSIAVCQKLLRQLPSTPQNCLGVRMDFE VPEEMRQAQQFRKEDAVLVIYEMLQQIFGILTRDFSSTGWSETIVEDLLVELQGQMDHLE PIQKEIMQRKNFTMGDMTVLHLKKYYFNLMKYLKSMEYNSCAWTVVRVQILMNFSFLKRL TVYLHD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggctctcctgctgtgtttctccaccacagctctc tccatgaactacagcttgcttcgattccagcaaaggaggagcattgctgtgtgtcagaag ctcctgcggcagttaccttcaactcctcaaaattgcctcggggtcaggatggacttcgag gtccctgaggagatgaggcaagcacagcagttccggaaggaagatgccgtattggtcatc tatgagatgctccagcagatcttcggtattctcaccagagacttctccagcactggctgg tctgagaccatcgttgaggacctccttgtggaactccaagggcagatggatcatctggag ccaatccagaaggaaatcatgcagaggaaaaacttcactatgggagacatgaccgttctt cacctgaagaaatattacttcaacctcatgaagtacctgaagtccatggagtacaacagc tgtgcctggacagttgttcgagtgcaaatactcatgaacttttctttcctgaagaggcta acagtttacctccatgactga

DBGET integrated database retrieval system