Cyanistes caeruleus (blue tit): 111935573 Help Entry 111935573         CDS       T05602                                  Name (RefSeq) thymosin beta-4-like isoform X1   KO K05764   thymosin, beta 4 Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ccae00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     111935573  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccae04812]     111935573 Cytoskeleton proteins [BR:ccae04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      111935573 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thymosin Motif Other DBs NCBI-GeneID:  111935573 NCBI-ProteinID:  XP_023791782 LinkDB All DBs Position 13 AA seq 86 aa AA seqDB search MLHWLPGFAHFYTLDHSAASVQHKEKLKFIATTVIPRPGPIMSDKPDFAEIETFDKTKLK KTETREKNPLPTKETIEQEKQSESTA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctccactggcttcctggttttgcacatttctatacactggatcattctgctgcctct gtgcaacacaaagaaaagttgaagttcattgcaaccacagtcatcccaaggccaggaccc atcatgtccgacaaaccagattttgcagaaattgaaacatttgacaagaccaagctgaag aagacagaaaccagagagaaaaatccactgcccactaaagaaactatcgaacaggaaaag caaagtgaaagtacagcctga

DBGET integrated database retrieval system