Cyanistes caeruleus (blue tit): 111937200 Help Entry 111937200         CDS       T05602                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae03050   Proteasome ccae04060   Cytokine-cytokine receptor interaction ccae04217   Necroptosis ccae04350   TGF-beta signaling pathway ccae05164   Influenza A ccae05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ccae00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     111937200 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     111937200 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111937200 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111937200 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     111937200 (IFNG)    05168 Herpes simplex virus 1 infection     111937200 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:ccae03051]     111937200 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccae04052]     111937200 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:ccae00536]     111937200 (IFNG) Proteasome [BR:ccae03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     111937200 (IFNG) Cytokines and neuropeptides [BR:ccae04052]  Cytokines   Interferons    111937200 (IFNG) Glycosaminoglycan binding proteins [BR:ccae00536]  Heparan sulfate / Heparin   Cytokines    111937200 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma Fib_alpha Sec8_N Lipoprotein_20 DUF948 ADIP ATG14 FtsL_2 Phage_GP20 Motif Other DBs NCBI-GeneID:  111937200 NCBI-ProteinID:  XP_023794238 UniProt:  A0A8C0UP85 LinkDB All DBs Position 1 AA seq 165 aa AA seqDB search MAFQTYSLFVLSVIMISFGHVENRLNLLQLQNDIDKLKADFNSSHSDVADGGPIFTERLS GWTERNEKRIILSQIISMYLKMLENTDRSKAHVRNISEELYTLKESLSDGSKKIEDLKDL TKLQMSDLKIQRKAVNELFSVLQKLGDTSSSHKRKRRQFQRMCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggctttccaaacctacagcttgtttgttctgtctgtcatcatgatttcttttggacat gttgagaatagattgaatcttcttcagcttcaaaacgatatagacaaactgaaagctgat tttaactcaagtcattctgatgtagctgatggtggacctatttttacagagaggctgtca ggctggacagagagaaatgaaaaaaggattatcctgagtcagattatttccatgtacttg aaaatgcttgaaaacaccgacaggtcaaaggctcatgtcaggaacatatctgaggagctc tatactctgaaagaaagcctttctgatggctcaaagaagatagaagatctcaaggacttg acaaaacttcagatgagtgacttgaaaattcagcgcaaggctgtgaatgagctgttcagt gtcttacaaaaactgggggatacctcaagttctcacaaaagaaaaagaagacaatttcag aggatgtgcaagtgctaa

DBGET integrated database retrieval system