Cyanistes caeruleus (blue tit): 111943368 Help Entry 111943368         CDS       T05602                                  Symbol BLVRB Name (RefSeq) flavin reductase (NADPH)   KO K05901   biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30] Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae00740   Riboflavin metabolism ccae00860   Porphyrin metabolism ccae01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:ccae00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00740 Riboflavin metabolism     111943368 (BLVRB)    00860 Porphyrin metabolism     111943368 (BLVRB) Enzymes [BR:ccae01000]  1. Oxidoreductases   1.3  Acting on the CH-CH group of donors    1.3.1  With NAD+ or NADP+ as acceptor     1.3.1.24  biliverdin reductase      111943368 (BLVRB)   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.30  flavin reductase (NADPH)      111943368 (BLVRB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NAD_binding_10 NrS1-1_pol-like_HBD Motif Other DBs NCBI-GeneID:  111943368 NCBI-ProteinID:  XP_023802122 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search KPPEFSLPRPSAFLLWEPERVPERLRALTEDHSRMERILRQSGLRCVYVMPPHIAVEQPL TGDYEVSVGVAGGPGSSRQISALDLGHFMLRCLRSDEFDGKSVYVSRHYPKE NT seq 339 nt NT seq  +upstreamnt  +downstreamnt aaaccccctgaattctccctgccccgcccctcagcgttcctgctgtgggagcccgagcgc gttcccgagcggctgcgggcgctgaccgaggatcattcccgcatggagcggatcctgcgg cagtcggggctgcgctgcgtctacgtcatgcccccgcacatcgccgtggagcagccgctc accggggattacgaggtatcggtgggcgtggccggcgggccgggatcctcccggcagatc tcggcactggatctcggacacttcatgctccgctgcctccggagcgacgagttcgacggg aagagcgtctacgtcagccgccactaccccaaggagtag

DBGET integrated database retrieval system