Cyanistes caeruleus (blue tit): 111945203 Help Entry 111945203         CDS       T05602                                  Symbol HYPK Name (RefSeq) huntingtin-interacting protein K   KO K28128   huntingtin-interacting protein K Organism ccae  Cyanistes caeruleus (blue tit) Brite KEGG Orthology (KO) [BR:ccae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ccae03110]     111945203 (HYPK)    03036 Chromosome and associated proteins [BR:ccae03036]     111945203 (HYPK) Chaperones and folding catalysts [BR:ccae03110]  Other chaperones and cochaperones   Others    111945203 (HYPK) Chromosome and associated proteins [BR:ccae03036]  Eukaryotic type   Sister chromatid cohesion proteins    Other sister chromatid cohesion factors     111945203 (HYPK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  UBA_HYPK UBA_7 Motif Other DBs NCBI-GeneID:  111945203 NCBI-ProteinID:  XP_023803645 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search SPLRTRPRHLLPCLTSRPFPGPLPAPHGCERPLLPASWPRCSGQRRLLVTGGLSISCRRE KELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALITLTN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt tcaccactcaggacacgacccaggcatctgcttccctgtctgacatcccggcccttcccc ggccccctcccggccccgcacggctgcgagcggccgctcctgcccgcctcatggccgagg tgcagtggccagcggcggctgttggtcaccggaggtttgtccatctcttgtcgtagggag aaagaactggcaaaagtgaccatcaagaaggaggatctagagctgattatgacggagatg gaaatatcacgggctgcagcagagcgcagcctgcgcgagcacatgggcaacgtggtggag gctcttatcaccctcaccaactga

DBGET integrated database retrieval system