Cajanus cajan (pigeon pea): 109790424 Help Entry 109790424         CDS       T04868                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj03420   Nucleotide excision repair ccaj04120   Ubiquitin mediated proteolysis ccaj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ccaj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109790424    04120 Ubiquitin mediated proteolysis     109790424   09124 Replication and repair    03420 Nucleotide excision repair     109790424  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccaj04121]     109790424    03400 DNA repair and recombination proteins [BR:ccaj03400]     109790424 Enzymes [BR:ccaj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109790424 Ubiquitin system [BR:ccaj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109790424   Multi subunit type E3    SCF complex     Ring finger protein      109790424    Cul2 complex      109790424    Cul3 complex      109790424    Cul4 complex      109790424    Cul7 complex      109790424    Cul8 complex      109790424    Cul9 complex      109790424 DNA repair and recombination proteins [BR:ccaj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109790424     TCR (transcription coupled repair) factors      Cul4-CSA complex       109790424 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  109790424 NCBI-ProteinID:  XP_020205159 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MATLDSDVPMVPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcaactcttgattccgacgttccgatggttcccgccggcgagccttcgagcagtgcc ggcccttcttccaagaagccgaagcgcttcgaaatcaaaaagtggaacgccgtcgctctc tgggcttgggacatcgttgttgataactgtgctatctgccggaaccacatcatggatctc tgcatcgagtgccaagccaaccaggctagcgccactagcgaggaatgcactgtggcttgg ggagtttgtaaccatgcttttcacttccattgcattagtcgatggctaaagacccgtcaa gtttgtcctctagataacagtgagtgggagtttcagaaatacggccactag

DBGET integrated database retrieval system