Cajanus cajan (pigeon pea): 109806089 Help Entry 109806089         CDS       T04868                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj03420   Nucleotide excision repair ccaj04120   Ubiquitin mediated proteolysis ccaj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ccaj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109806089    04120 Ubiquitin mediated proteolysis     109806089   09124 Replication and repair    03420 Nucleotide excision repair     109806089  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccaj04121]     109806089    03400 DNA repair and recombination proteins [BR:ccaj03400]     109806089 Enzymes [BR:ccaj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109806089 Ubiquitin system [BR:ccaj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109806089   Multi subunit type E3    SCF complex     Ring finger protein      109806089    Cul2 complex      109806089    Cul3 complex      109806089    Cul4 complex      109806089    Cul7 complex      109806089    Cul8 complex      109806089    Cul9 complex      109806089 DNA repair and recombination proteins [BR:ccaj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109806089     TCR (transcription coupled repair) factors      Cul4-CSA complex       109806089 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  109806089 NCBI-ProteinID:  XP_020224033 LinkDB All DBs Position 10:4108854..4111804 Genome browser AA seq 116 aa AA seqDB search MATLDSDVTMVPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgactctggattccgacgtgacgatggttccggccggcgagccttccagcagcgcc ggtccttcttccaagaagccgaagcgattcgagatcaagaagtggaatgccgttgctctc tgggcttgggacatcgttgtcgataactgcgccatctgccggaaccatatcatggatctc tgtattgagtgccaggccaaccaggctagcgccaccagcgaggaatgcaccgtggcttgg ggagtttgtaaccatgcttttcatttccattgcataagccgatggctcaagactcgtcaa gtatgccctttagataatagcgagtgggagtttcagaaatacggtcactag

DBGET integrated database retrieval system