Cajanus cajan (pigeon pea): 109809217 Help Entry 109809217         CDS       T04868                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj00510   N-Glycan biosynthesis ccaj00513   Various types of N-glycan biosynthesis ccaj04141   Protein processing in endoplasmic reticulum Module ccaj_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ccaj00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     109809217    00513 Various types of N-glycan biosynthesis     109809217  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109809217 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Yip1 Motif Other DBs NCBI-GeneID:  109809217 NCBI-ProteinID:  XP_020228055 LinkDB All DBs Position 11:complement(41141410..41143216) Genome browser AA seq 76 aa AA seqDB search MAPKAITSPVPDAWYPALSVLTLVIGLLLTASFFIYEATSSRKSRSLAQELITGAVASVF LGFGSLFLLLACGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccaaaagcaataacgagtccggtccccgatgcgtggtaccctgcactctccgtc ctcactctcgtcatcggcctcctcttaaccgcctctttcttcatttatgaagcaacctct tctaggaaaagtcgttcacttgctcaggagctgataactggagcagtggcgtcagtgttc ttgggttttggatccttgttcctcctacttgcttgtggcgtttatgtctaa

DBGET integrated database retrieval system