Ceratina calcarata (carpenter bee): 108632991 Help Entry 108632991         CDS       T06061                                  Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ccal  Ceratina calcarata (carpenter bee) Pathway ccal00670   One carbon pool by folate ccal00790   Folate biosynthesis ccal01100   Metabolic pathways ccal01240   Biosynthesis of cofactors ccal04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:ccal00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     108632991    00670 One carbon pool by folate     108632991  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     108632991 Enzymes [BR:ccal01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      108632991 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  108632991 NCBI-ProteinID:  XP_017893381 UniProt:  A0AAJ7NG24 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search MSLNLNLIAAACDGMGIGVKGTLPWKLKSEMAFFTSMTSNTKHPDKRNVVLMGRRTWECI PKKYRPLQNRINIVLSSQFLDYGKDAIVCKNIPHALEIIGKPPLKDQIENIWVIGGSSVY K NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgagtttaaatttgaatttaattgcggcagcatgcgatggcatgggtattggtgtaaaa ggaactttaccatggaaactgaaaagtgaaatggctttttttacatcaatgacttcgaat acgaaacacccagataaaaggaatgttgttcttatgggacgaaggacgtgggaatgcatt ccaaagaagtacagaccgttacaaaatcgaataaacatagttctatcgtcgcaatttttg gattacggaaaagatgcgatcgtatgtaaaaacattccacatgctcttgaaatcattgga aaacctccactgaaagatcaaattgagaatatatgggttataggaggcagttctgtgtat aag

DBGET integrated database retrieval system