Castor canadensis (American beaver): 109676142 Help Entry 109676142         CDS       T04791                                  Symbol Ifng Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism ccan  Castor canadensis (American beaver) Pathway ccan03050   Proteasome ccan04060   Cytokine-cytokine receptor interaction ccan04066   HIF-1 signaling pathway ccan04217   Necroptosis ccan04350   TGF-beta signaling pathway ccan04380   Osteoclast differentiation ccan04612   Antigen processing and presentation ccan04630   JAK-STAT signaling pathway ccan04650   Natural killer cell mediated cytotoxicity ccan04657   IL-17 signaling pathway ccan04658   Th1 and Th2 cell differentiation ccan04659   Th17 cell differentiation ccan04660   T cell receptor signaling pathway ccan04940   Type I diabetes mellitus ccan05140   Leishmaniasis ccan05142   Chagas disease ccan05143   African trypanosomiasis ccan05144   Malaria ccan05145   Toxoplasmosis ccan05146   Amoebiasis ccan05152   Tuberculosis ccan05160   Hepatitis C ccan05164   Influenza A ccan05168   Herpes simplex virus 1 infection ccan05200   Pathways in cancer ccan05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccan05321   Inflammatory bowel disease ccan05322   Systemic lupus erythematosus ccan05323   Rheumatoid arthritis ccan05330   Allograft rejection ccan05332   Graft-versus-host disease ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     109676142 (Ifng)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     109676142 (Ifng)    04630 JAK-STAT signaling pathway     109676142 (Ifng)    04066 HIF-1 signaling pathway     109676142 (Ifng)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109676142 (Ifng)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109676142 (Ifng)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     109676142 (Ifng)    04612 Antigen processing and presentation     109676142 (Ifng)    04660 T cell receptor signaling pathway     109676142 (Ifng)    04658 Th1 and Th2 cell differentiation     109676142 (Ifng)    04659 Th17 cell differentiation     109676142 (Ifng)    04657 IL-17 signaling pathway     109676142 (Ifng)   09158 Development and regeneration    04380 Osteoclast differentiation     109676142 (Ifng)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109676142 (Ifng)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109676142 (Ifng)   09172 Infectious disease: viral    05160 Hepatitis C     109676142 (Ifng)    05164 Influenza A     109676142 (Ifng)    05168 Herpes simplex virus 1 infection     109676142 (Ifng)   09171 Infectious disease: bacterial    05152 Tuberculosis     109676142 (Ifng)   09174 Infectious disease: parasitic    05146 Amoebiasis     109676142 (Ifng)    05144 Malaria     109676142 (Ifng)    05145 Toxoplasmosis     109676142 (Ifng)    05140 Leishmaniasis     109676142 (Ifng)    05142 Chagas disease     109676142 (Ifng)    05143 African trypanosomiasis     109676142 (Ifng)   09163 Immune disease    05322 Systemic lupus erythematosus     109676142 (Ifng)    05323 Rheumatoid arthritis     109676142 (Ifng)    05321 Inflammatory bowel disease     109676142 (Ifng)    05330 Allograft rejection     109676142 (Ifng)    05332 Graft-versus-host disease     109676142 (Ifng)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109676142 (Ifng)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109676142 (Ifng)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:ccan03051]     109676142 (Ifng)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109676142 (Ifng)    00536 Glycosaminoglycan binding proteins [BR:ccan00536]     109676142 (Ifng) Proteasome [BR:ccan03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     109676142 (Ifng) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Interferons    109676142 (Ifng) Glycosaminoglycan binding proteins [BR:ccan00536]  Heparan sulfate / Heparin   Cytokines    109676142 (Ifng) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma API5 DUF1765 Motif Other DBs NCBI-GeneID:  109676142 NCBI-ProteinID:  XP_020008231 UniProt:  A0A8B7TMP8 LinkDB All DBs Position Unknown AA seq 174 aa AA seqDB search MNYTSYILAFQLCIILGSSSCYCQATFFKEIENLKEYFNASTSDVADGKPLFIDILKDWK EESDKKIIQSQIVSFYFKLFESLKDNQHIQKSMDTIKEDLFVKFFNSSSNKLNDFVKLTQ IPVNDPQVQRKAISELIKVMNDLSPRSVLKKRKRSRCCFGAAEHPIKTRPSSIS NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaagttatatcttggcttttcagctctgcatcattttgggttcttcaagc tgttactgccaggccacattttttaaagaaatagaaaatctcaaggaatattttaatgca agcacttcagatgtagcagatgggaagcctcttttcatagatattttgaaggactggaaa gaggagagtgacaaaaaaataattcagagccaaattgtctccttctacttcaaactcttt gaaagcttaaaagacaaccagcacatccagaagagcatggacaccatcaaggaagacctg tttgttaagttcttcaacagcagcagcaacaaactgaatgacttcgtaaagctgactcag attccggtaaatgacccacaggtccaacgcaaagccatcagtgaactcatcaaagtgatg aatgacctgtctccaagatctgtcctaaagaagagaaaaaggagtcggtgctgctttggg gctgcagagcatccaattaagactcgtccttccagcattagttga

DBGET integrated database retrieval system