Castor canadensis (American beaver): 109679557 Help Entry 109679557         CDS       T04791                                  Symbol Il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism ccan  Castor canadensis (American beaver) Pathway ccan01521   EGFR tyrosine kinase inhibitor resistance ccan01523   Antifolate resistance ccan04060   Cytokine-cytokine receptor interaction ccan04061   Viral protein interaction with cytokine and cytokine receptor ccan04066   HIF-1 signaling pathway ccan04068   FoxO signaling pathway ccan04151   PI3K-Akt signaling pathway ccan04218   Cellular senescence ccan04620   Toll-like receptor signaling pathway ccan04621   NOD-like receptor signaling pathway ccan04623   Cytosolic DNA-sensing pathway ccan04625   C-type lectin receptor signaling pathway ccan04630   JAK-STAT signaling pathway ccan04640   Hematopoietic cell lineage ccan04657   IL-17 signaling pathway ccan04659   Th17 cell differentiation ccan04668   TNF signaling pathway ccan04672   Intestinal immune network for IgA production ccan04931   Insulin resistance ccan04932   Non-alcoholic fatty liver disease ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan04936   Alcoholic liver disease ccan05010   Alzheimer disease ccan05020   Prion disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05132   Salmonella infection ccan05133   Pertussis ccan05134   Legionellosis ccan05135   Yersinia infection ccan05142   Chagas disease ccan05143   African trypanosomiasis ccan05144   Malaria ccan05146   Amoebiasis ccan05152   Tuberculosis ccan05161   Hepatitis B ccan05162   Measles ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05166   Human T-cell leukemia virus 1 infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05168   Herpes simplex virus 1 infection ccan05169   Epstein-Barr virus infection ccan05171   Coronavirus disease - COVID-19 ccan05200   Pathways in cancer ccan05202   Transcriptional misregulation in cancer ccan05321   Inflammatory bowel disease ccan05323   Rheumatoid arthritis ccan05332   Graft-versus-host disease ccan05410   Hypertrophic cardiomyopathy ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109679557 (Il6)    04668 TNF signaling pathway     109679557 (Il6)    04066 HIF-1 signaling pathway     109679557 (Il6)    04068 FoxO signaling pathway     109679557 (Il6)    04151 PI3K-Akt signaling pathway     109679557 (Il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109679557 (Il6)    04061 Viral protein interaction with cytokine and cytokine receptor     109679557 (Il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     109679557 (Il6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109679557 (Il6)    04620 Toll-like receptor signaling pathway     109679557 (Il6)    04621 NOD-like receptor signaling pathway     109679557 (Il6)    04623 Cytosolic DNA-sensing pathway     109679557 (Il6)    04625 C-type lectin receptor signaling pathway     109679557 (Il6)    04659 Th17 cell differentiation     109679557 (Il6)    04657 IL-17 signaling pathway     109679557 (Il6)    04672 Intestinal immune network for IgA production     109679557 (Il6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109679557 (Il6)    05202 Transcriptional misregulation in cancer     109679557 (Il6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109679557 (Il6)    05161 Hepatitis B     109679557 (Il6)    05171 Coronavirus disease - COVID-19     109679557 (Il6)    05164 Influenza A     109679557 (Il6)    05162 Measles     109679557 (Il6)    05168 Herpes simplex virus 1 infection     109679557 (Il6)    05163 Human cytomegalovirus infection     109679557 (Il6)    05167 Kaposi sarcoma-associated herpesvirus infection     109679557 (Il6)    05169 Epstein-Barr virus infection     109679557 (Il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     109679557 (Il6)    05135 Yersinia infection     109679557 (Il6)    05133 Pertussis     109679557 (Il6)    05134 Legionellosis     109679557 (Il6)    05152 Tuberculosis     109679557 (Il6)   09174 Infectious disease: parasitic    05146 Amoebiasis     109679557 (Il6)    05144 Malaria     109679557 (Il6)    05142 Chagas disease     109679557 (Il6)    05143 African trypanosomiasis     109679557 (Il6)   09163 Immune disease    05323 Rheumatoid arthritis     109679557 (Il6)    05321 Inflammatory bowel disease     109679557 (Il6)    05332 Graft-versus-host disease     109679557 (Il6)   09164 Neurodegenerative disease    05010 Alzheimer disease     109679557 (Il6)    05020 Prion disease     109679557 (Il6)    05022 Pathways of neurodegeneration - multiple diseases     109679557 (Il6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109679557 (Il6)    05410 Hypertrophic cardiomyopathy     109679557 (Il6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109679557 (Il6)    04932 Non-alcoholic fatty liver disease     109679557 (Il6)    04931 Insulin resistance     109679557 (Il6)    04933 AGE-RAGE signaling pathway in diabetic complications     109679557 (Il6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109679557 (Il6)    01523 Antifolate resistance     109679557 (Il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109679557 (Il6) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Interleukins    109679557 (Il6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL23 MIP-T3_C Motif Other DBs NCBI-GeneID:  109679557 NCBI-ProteinID:  XP_020010314 UniProt:  A0A8B7TRD4 LinkDB All DBs Position Unknown AA seq 214 aa AA seqDB search MKFHSKSTFCPLAFLGLLLVTATAFPTSEVLREDFTDDANQNRPTHASSQKIEDQISYIL KEILELRKRWLCGNDENCLNNEEAVSENKLNLPMMTLKDGCFQTGYNRDTCILKVTSGLL EFQIYLEYIHNTFQDNEKKNRIRDVQSNTKSLIQNLKQQVKNPDKIVFPSPTANATLLEK LQSQNNWQKTMTINIILRSLEDFLQFSLRALRKP NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atgaagttccactccaaaagcaccttctgtccacttgccttcttggggctgctcctggtg acagctactgccttccccacctcagaagtcctgagagaagacttcacagatgatgctaac caaaatagaccaacacatgcctcttcacaaaaaatcgaagaccagatttcatatatcctc aaggaaatcctggaattgagaaagaggtggttgtgtggcaatgatgaaaactgtctgaac aatgaggaagcagtgtcagaaaacaaactgaaccttccaatgatgacattaaaagatgga tgcttccaaactggatacaatcgggacacttgcatattgaaagtcaccagtggacttctg gagttccagatttacctggagtacatccacaacacatttcaggataacgagaaaaagaac agaatcagagatgtgcagagcaataccaaatccctgattcagaacctgaaacaacaggta aagaatccagataaaatagtcttccctagcccaactgcaaacgccactctgctggagaag ctgcagtcacagaacaattggcagaagaccatgacgattaacatcattctgcgcagcctt gaagatttcctgcaattcagcctgcgggctcttagaaaaccatag

DBGET integrated database retrieval system