Castor canadensis (American beaver): 109680045 Help Entry 109680045         CDS       T04791                                  Name (RefSeq) CD209 antigen-like protein E   KO K06563   C-type lectin domain family 4 member L/M Organism ccan  Castor canadensis (American beaver) Pathway ccan03260   Virion - Human immunodeficiency virus ccan03264   Virion - Flavivirus and Alphavirus ccan03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus ccan03273   Virion - Lassa virus and SFTS virus ccan04145   Phagosome ccan04625   C-type lectin receptor signaling pathway ccan05152   Tuberculosis ccan05162   Measles Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     109680045    03264 Virion - Flavivirus and Alphavirus     109680045    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     109680045    03273 Virion - Lassa virus and SFTS virus     109680045  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     109680045  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109680045  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     109680045   09171 Infectious disease: bacterial    05152 Tuberculosis     109680045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccan04131]     109680045   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:ccan04054]     109680045    04090 CD molecules [BR:ccan04090]     109680045    04091 Lectins [BR:ccan04091]     109680045 Membrane trafficking [BR:ccan04131]  Endocytosis   Phagocytosis    C-lectin receptors     109680045 Pattern recognition receptors [BR:ccan04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    109680045 CD molecules [BR:ccan04090]  Proteins   109680045 Lectins [BR:ccan04091]  C-Type lectins   Asialoglycoprotein and DC receptors    109680045 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  109680045 NCBI-ProteinID:  XP_020010638 UniProt:  A0A8B7TSW8 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MMGYNEVRARQLGILGYAHTLLVLQLLSITLLAGVLLAILAQGSKDPSSPGMENIYQELS QLKAEVDLLCHRCPWDWSFFQGNCYFFSKIQNDWNNSVLACQEAGARLVAIKSDEEKTFL QVMFKTTKAAWIGLSDLTNEGRWHWLDGSPLSQ NT seq 461 nt NT seq  +upstreamnt  +downstreamnt atgatgggctacaatgaagtgagggcacgacagctggggattctgggctacgcccacact ctcctggtgctgcagctgctctccatcacactcttggctggggttctgctggccatcctt gcccaaggttccaaggaccccagctctccagggatggagaacatctaccaggaactgagc cagctgaaggctgaagtggacctcctgtgccaccgctgcccctgggactggtccttcttc caaggaaattgttacttcttctccaagatccaaaatgactggaataactctgtccttgcc tgtcaggaagcaggagcccgactagtggctatcaaaagtgatgaggagaagaccttcctg caagtgatgtttaagacgacaaaagcagcctggattggtctctcagacctgacaaatgaa ggcaggtggcactggctggatggctcacctctgtcacaaag

DBGET integrated database retrieval system