Castor canadensis (American beaver): 109686224 Help Entry 109686224         CDS       T04791                                  Symbol Cdk4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism ccan  Castor canadensis (American beaver) Pathway ccan01522   Endocrine resistance ccan04110   Cell cycle ccan04115   p53 signaling pathway ccan04151   PI3K-Akt signaling pathway ccan04218   Cellular senescence ccan04530   Tight junction ccan04660   T cell receptor signaling pathway ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan04934   Cushing syndrome ccan05160   Hepatitis C ccan05162   Measles ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05165   Human papillomavirus infection ccan05166   Human T-cell leukemia virus 1 infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05169   Epstein-Barr virus infection ccan05200   Pathways in cancer ccan05203   Viral carcinogenesis ccan05212   Pancreatic cancer ccan05214   Glioma ccan05218   Melanoma ccan05219   Bladder cancer ccan05220   Chronic myeloid leukemia ccan05222   Small cell lung cancer ccan05223   Non-small cell lung cancer ccan05224   Breast cancer ccan05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     109686224 (Cdk4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     109686224 (Cdk4)    04115 p53 signaling pathway     109686224 (Cdk4)    04218 Cellular senescence     109686224 (Cdk4)   09144 Cellular community - eukaryotes    04530 Tight junction     109686224 (Cdk4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     109686224 (Cdk4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109686224 (Cdk4)    05203 Viral carcinogenesis     109686224 (Cdk4)   09162 Cancer: specific types    05212 Pancreatic cancer     109686224 (Cdk4)    05225 Hepatocellular carcinoma     109686224 (Cdk4)    05214 Glioma     109686224 (Cdk4)    05220 Chronic myeloid leukemia     109686224 (Cdk4)    05218 Melanoma     109686224 (Cdk4)    05219 Bladder cancer     109686224 (Cdk4)    05224 Breast cancer     109686224 (Cdk4)    05222 Small cell lung cancer     109686224 (Cdk4)    05223 Non-small cell lung cancer     109686224 (Cdk4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109686224 (Cdk4)    05160 Hepatitis C     109686224 (Cdk4)    05164 Influenza A     109686224 (Cdk4)    05162 Measles     109686224 (Cdk4)    05163 Human cytomegalovirus infection     109686224 (Cdk4)    05167 Kaposi sarcoma-associated herpesvirus infection     109686224 (Cdk4)    05169 Epstein-Barr virus infection     109686224 (Cdk4)    05165 Human papillomavirus infection     109686224 (Cdk4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     109686224 (Cdk4)    04934 Cushing syndrome     109686224 (Cdk4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     109686224 (Cdk4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ccan01001]     109686224 (Cdk4) Enzymes [BR:ccan01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      109686224 (Cdk4) Protein kinases [BR:ccan01001]  Serine/threonine kinases: CMGC group   CDK family    109686224 (Cdk4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  109686224 NCBI-ProteinID:  XP_020019040 UniProt:  A0A8B7ULM4 LinkDB All DBs Position Unknown AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFAPRGPHPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEEG DPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgatatgagcctgtggctgaaattggtgtcggtgcgtatgggacggtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc aatggaggaggagccggagggggccttcccatcagcacagttcgtgaggtggccttactg aggcggctggaggcttttgagcaccccaatgttgtccggctgatggacgtctgtgccact tcccgaactgaccgggagatcaaggtgaccctagtatttgagcatgtagaccaagaccta aggacatatctggacaaggcacccccaccaggcttgccagctgagaccatcaaggatctg atgcgccagtttctaagaggtctagattttcttcatgccaattgcatcgtccaccgagac ctgaagccagagaacattctggtgacgagtggtgggacagtcaaattggctgactttggc ttggccagaatctacagctaccagatggcccttacacctgtggttgttacactctggtac cgtgctcctgaagttcttctacagtctacatatgcaacacctgtggacatgtggagtgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagttagggaaaatctttgatctgattggactgcccccagaggatgactggcctcga gatgtatctctacccagaggagcctttgcccccagaggacctcatccagtgcagtcagtg gtgcctgagatggaagagtctggagcacagctgctgctggaaatgctgacttttaaccca cacaagagaatttctgccttccgagccctgcagcactcttatctacataaggaagaaggt gatccggagtga

DBGET integrated database retrieval system