Castor canadensis (American beaver): 109686914 Help Entry 109686914         CDS       T04791                                  Symbol Rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ccan  Castor canadensis (American beaver) Pathway ccan03420   Nucleotide excision repair ccan04066   HIF-1 signaling pathway ccan04110   Cell cycle ccan04114   Oocyte meiosis ccan04120   Ubiquitin mediated proteolysis ccan04141   Protein processing in endoplasmic reticulum ccan04310   Wnt signaling pathway ccan04350   TGF-beta signaling pathway ccan04710   Circadian rhythm ccan05170   Human immunodeficiency virus 1 infection ccan05200   Pathways in cancer ccan05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109686914 (Rbx1)    04120 Ubiquitin mediated proteolysis     109686914 (Rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     109686914 (Rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     109686914 (Rbx1)    04350 TGF-beta signaling pathway     109686914 (Rbx1)    04066 HIF-1 signaling pathway     109686914 (Rbx1)  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     109686914 (Rbx1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109686914 (Rbx1)   09162 Cancer: specific types    05211 Renal cell carcinoma     109686914 (Rbx1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109686914 (Rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccan04121]     109686914 (Rbx1)    03400 DNA repair and recombination proteins [BR:ccan03400]     109686914 (Rbx1) Enzymes [BR:ccan01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109686914 (Rbx1) Ubiquitin system [BR:ccan04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109686914 (Rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      109686914 (Rbx1)    Cul2 complex      109686914 (Rbx1)    Cul3 complex      109686914 (Rbx1)    Cul4 complex      109686914 (Rbx1)    Cul7 complex      109686914 (Rbx1)    Cul8 complex      109686914 (Rbx1)    Cul9 complex      109686914 (Rbx1) DNA repair and recombination proteins [BR:ccan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109686914 (Rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       109686914 (Rbx1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  109686914 NCBI-ProteinID:  XP_020020067 UniProt:  A0A250Y906 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag cgctttgaagtgaaaaagtggaatgcagtagccttgtgggcctgggatattgtggttgat aactgtgccatctgcaggaatcacattatggatctttgcatagagtgtcaagctaaccag gcgtctgctacatctgaagagtgtaccgttgcgtggggagtctgtaaccatgcttttcac ttccactgcatctctcgctggctcaaaacacggcaggtgtgtccgttggacaacagagag tgggaattccaaaagtatgggcactag

DBGET integrated database retrieval system